TkA02G046720 | RubberDandelionOmics

Gene overview

TkA02G046720

Reference: TK1151 Chr: Chr02 Coordinates: 12035160-12038236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1625 bp · TkA02G046720|TK1151|cDNA

CGGCTGTCTGCCTAAAACCCTAAACCCCAAAATATGGCGGTCCATTCTCTCCTCCGGCGAGTCCTATTCAGATCACCACCGATTATTCCGTCATCAGCCGGCGTCAGAACTGCAGCCGCACCGTACCACGACGTTCAAATGAAAAACTACTCAACCGAATTCACCAAAGCGGAAGATCAGAACACCGAGAACAAGAAAGGAAAGTGGTTAACTTTGCCGCCTTTCAGTATTACCGTTAACGGTGCTTCATTGGGAAAAGA...

CDS

Download CDS FASTA

1440 bp · TkA02G046720|TK1151|CDS

ATGGCGGTCCATTCTCTCCTCCGGCGAGTCCTATTCAGATCACCACCGATTATTCCGTCATCAGCCGGCGTCAGAACTGCAGCCGCACCGTACCACGACGTTCAAATGAAAAACTACTCAACCGAATTCACCAAAGCGGAAGATCAGAACACCGAGAACAAGAAAGGAAAGTGGTTAACTTTGCCGCCTTTCAGTATTACCGTTAACGGTGCTTCATTGGGAAAAGATATTGTCGGAAGACGGCAGTCGACCAGTGAAGG...

Protein

Download Protein FASTA

479 aa · TkA02G046720|TK1151|PROTEIN

MAVHSLLRRVLFRSPPIIPSSAGVRTAAAPYHDVQMKNYSTEFTKAEDQNTENKKGKWLTLPPFSITVNGASLGKDIVGRRQSTSEGDANASTTTALKWVTQCCPQLPRSLVQKLFRLRQVRRETSEDSFSDQDVQAPVSRVKRVAAKDSMKPGDTIHLPISVQSSPIEKPECICSEEELKFLHDLELYKDSAIIVINKPPGMPVQGGIGIKRSLDELVGTYLRHDFSEPPRLVHRLDRDSSGILVLGRTQLSATVLHSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G046720`
TK1151 ID	TkA02G046720
OH-1004 ID	LXL04_017373
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G046720

Location Chr02:12035160-12038236 (-)

Description Similar to At3g19440: RNA pseudouridine synthase 4, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19440`	RNA pseudouridine synthase 4, mitochondrial.	No verified direct reference in this release
`At1g78910`	RNA pseudouridine synthase 3, mitochondrial.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0520100`	RNA pseudouridine synthase 3, mitochondrial.	No verified direct reference in this release
`Os09g0103500`	RNA pseudouridine synthase 4, mitochondrial.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000455 enzyme-directed rRNA pseudouridine synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0009982 pseudouridine synthase activity Molecular Function

GO:0160141 23S rRNA pseudouridine(955/2504/2580) synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78910

ath:AT3G19440

dosa:Os08g0520100

dosa:Os09g0103500

rty:RT0249

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.870

Rank 1 · TkA02G046720 · TK1151

Nucleus0.083

Rank 2 · TkA02G046720 · TK1151

Cytoplasm0.080

Rank 3 · TkA02G046720 · TK1151

Plastid0.053

Rank 4 · TkA02G046720 · TK1151

Cell membrane0.017

Rank 5 · TkA02G046720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00849PseudoU_synth_2194-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G046720	`PF00849`	PseudoU_synth_2	194	364	5.3e-25	89.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT72`	Arabidopsis thaliana	sp\|Q9LT72\|PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial	54.000%	Swiss-Prot	High
`Q5XET6`	Arabidopsis thaliana	sp\|Q5XET6\|PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial	39.200%	Swiss-Prot	Medium
`Q0J4D4`	Oryza sativa subsp. japonica	sp\|Q0J4D4\|PUS3_ORYSJ RNA pseudouridine synthase 3, mitochondrial	40.700%	Swiss-Prot	Medium
`Q69K07`	Oryza sativa subsp. japonica	sp\|Q69K07\|PUS4_ORYSJ RNA pseudouridine synthase 4, mitochondrial	50.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card