TkA02G046180 | RubberDandelionOmics

Gene overview

TkA02G046180

Reference: TK1151 Chr: Chr02 Coordinates: 11888047-11889335 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

920 bp · TkA02G046180|TK1151|cDNA

AAAAAACTGAAATCAGCAGCCCAGTTGCACGAGAAGATTACACGATAAACCCACCGGGCCTAGGGCACACTCGAAGATGTCAATCCCCAAACACAATTCGGAAGTAGAGATCGTCGGCTTTCACCGGCATCGTAATCCGGCGTAATTTTTCTTCAGGAGGTGGATATCTTCATATCCCTGTTCTTATTACATCGAAGGTTAGGTTTTATTCACCGGGAAGAACGATGTCTAGTTCAGGTAGACCGTTGGCGTCCGCTGCG...

CDS

Download CDS FASTA

456 bp · TkA02G046180|TK1151|CDS

ATGTCTAGTTCAGGTAGACCGTTGGCGTCCGCTGCGAGTAGAGACTTACAGATTGTATCGGCGCCTTCAGATAGAACAGCGATCTCTGCTCTTCCTCCTCGCCATCCGACTAATTCATCCTCAGCTCTTGTTGAATACACACCACCTGTACCTAATCAGGAGGAGGAGGACCTCGAGGTGAAGCTCCGTCGCATATTAGATCACGTCCCTGTTCGTGTCAACAACACTTCGGGTAGTTCCGCCGGTTCTGGCTCCGGTGA...

Protein

Download Protein FASTA

151 aa · TkA02G046180|TK1151|PROTEIN

MSSSGRPLASAASRDLQIVSAPSDRTAISALPPRHPTNSSSALVEYTPPVPNQEEEDLEVKLRRILDHVPVRVNNTSGSSAGSGSGDFHQYRQMRRKEQDRITRMDVDYRKKKQVAEFNKRREERLKATEERTAKKRLKRQKRSKKSKKRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G046180`
TK1151 ID	TkA02G046180
OH-1004 ID	LXL04_017377
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 86.093 / OH-1004 73.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G046180`
Location	Chr02:11888047-11889335 (-)
Description	Similar to PRKRIP1: PRKR-interacting protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017377` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0003014 renal system process Biological Process GO:0006397 mRNA processing Biological Process GO:0006469 negative regulation of protein kinase activity Biological Process GO:0008380 RNA splicing Biological Process GO:0042326 negative regulation of phosphorylation Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0015629 actin cytoskeleton Cellular Component GO:0070062 extracellular exosome Cellular Component
KEGG gene cross-reference	bta:780786 gga:417508 hsa:79706 mmu:66801 pon:100173758 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · TkA02G046180 · TK1151

Cytoplasm0.147

Rank 2 · TkA02G046180 · TK1151

Mitochondrion0.024

Rank 3 · TkA02G046180 · TK1151

Cell membrane0.015

Rank 4 · TkA02G046180 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA02G046180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15670Spem148-142 aa

PF06658DUF116862-150 aa

PF27831HTLV1ZIPPER77-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G046180	`PF15670`	Spem1	48	142	0.83	9.8
TkA02G046180	`PF06658`	DUF1168	62	150	1.7e-23	83.7
TkA02G046180	`PF27831`	HTLV1ZIPPER	77	150	0.59	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card