Gene Card
Gene overview
cDNA / CDS / Protein Sequences
537 bp · LXL04_017377|LXL04_017377|OH1004|cDNA
ATGTCTAGTTCAGGTAGACCGTTGGCGTCCGCTGCGAGTAGAGACTTACAGATTGTATCGGCGCCTTCAGATAGAACAGCGATCTCTGCTCTTCCTCCTCGCCATCCGACTAATTCATCCTCAGCTCTTGTTGAATACACACCACCTGTACCTAATCAGGAGGAGGAGGACCTCGAGGTGAAGCTCCGTCGCATATTAGATCACGTCCCTGTTCGTGTCAACAACACTTCGGGTAGTTCCGCCGGTTCTGGCTCCGGTGA...
537 bp · LXL04_017377|LXL04_017377|OH1004|CDS
ATGTCTAGTTCAGGTAGACCGTTGGCGTCCGCTGCGAGTAGAGACTTACAGATTGTATCGGCGCCTTCAGATAGAACAGCGATCTCTGCTCTTCCTCCTCGCCATCCGACTAATTCATCCTCAGCTCTTGTTGAATACACACCACCTGTACCTAATCAGGAGGAGGAGGACCTCGAGGTGAAGCTCCGTCGCATATTAGATCACGTCCCTGTTCGTGTCAACAACACTTCGGGTAGTTCCGCCGGTTCTGGCTCCGGTGA...
Protein
Download Protein FASTA178 aa · LXL04_017377|LXL04_017377|OH1004|PROTEIN
MSSSGRPLASAASRDLQIVSAPSDRTAISALPPRHPTNSSSALVEYTPPVPNQEEEDLEVKLRRILDHVPVRVNNTSGSSAGSGSGDFHQYRQMRRKEQDRITRMDVDYRKKKQVAEFNKRREERLKATEERTAKKRLKRQKKKQKKQEKKMKVEGGNPEEHRKEEDDKSSDDEDDQE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_017377 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_017377 |
|---|---|
| Location | Chr03:147869812-147870716 (+) |
| Description | Similar to PRKRIP1: PRKR-interacting protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0003014 renal system process Biological Process GO:0006397 mRNA processing Biological Process GO:0006469 negative regulation of protein kinase activity Biological Process GO:0008380 RNA splicing Biological Process GO:0042326 negative regulation of phosphorylation Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0015629 actin cytoskeleton Cellular Component GO:0070062 extracellular exosome Cellular Component |
| KEGG gene cross-reference | bta:780786 gga:417508 hsa:79706 mmu:66801 pon:100173758 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06658.18DUF116862-176 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_017377 | PF06658.18 | DUF1168 | 62 | 176 | 8.3e-28 | 97.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.