TkA02G044630 | RubberDandelionOmics

Gene overview

TkA02G044630

Reference: TK1151 Chr: Chr02 Coordinates: 11495297-11497528 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1464 bp · TkA02G044630|TK1151|cDNA

ATGAAGATCGCAATATTTCTTCTCTCGATCCATTTCTGCCTCCTGGTTCTCGCCCATTGCTATGGTGGCAACGGATATGATCCTCTAGAGAGCATTTTAAACATCCAACGTTCTAAAAGATCGGATCATATCATTAACAAAGAGGTGATCACATCCGAGATCTCATACTCACGTGTTTACGTGGGCCCTCAAGACGGGTTAAAGGATGTGGACAAGATATCATCTTTGCCGGGTGAACCATCGGGAACTGACTTTGACCA...

CDS

Download CDS FASTA

1464 bp · TkA02G044630|TK1151|CDS

ATGAAGATCGCAATATTTCTTCTCTCGATCCATTTCTGCCTCCTGGTTCTCGCCCATTGCTATGGTGGCAACGGATATGATCCTCTAGAGAGCATTTTAAACATCCAACGTTCTAAAAGATCGGATCATATCATTAACAAAGAGGTGATCACATCCGAGATCTCATACTCACGTGTTTACGTGGGCCCTCAAGACGGGTTAAAGGATGTGGACAAGATATCATCTTTGCCGGGTGAACCATCGGGAACTGACTTTGACCA...

Protein

Download Protein FASTA

487 aa · TkA02G044630|TK1151|PROTEIN

MKIAIFLLSIHFCLLVLAHCYGGNGYDPLESILNIQRSKRSDHIINKEVITSEISYSRVYVGPQDGLKDVDKISSLPGEPSGTDFDQYSGYVTVDPNHGRALFYYLAESPIFSSNNPLVLWLNGGPGCSSFGNGAMMELGPFRVNADSVTLSRNKYAWNNVANILFLESPAGVGFSYSNTSSDYTTGDIQTAKDSYTFLVNWLERFPEYKTRDFYITGESYAGHYVPQLAQLILQNNKITNQTIINLKGIALGNAYVDEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G044630`
TK1151 ID	TkA02G044630
OH-1004 ID	LXL04_017430
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G044630

Location Chr02:11495297-11497528 (-)

Description Similar to SCP1: Serine carboxypeptidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63470`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g24010`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g07990`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017430 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24010

ath:AT3G07990

ath:AT3G63470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.485

Rank 1 · TkA02G044630 · TK1151

Extracellular0.258

Rank 2 · TkA02G044630 · TK1151

Cytoplasm0.115

Rank 3 · TkA02G044630 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA02G044630 · TK1151

Cell membrane0.053

Rank 5 · TkA02G044630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1081-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G044630	`PF00450`	Peptidase_S10	81	483	3e-136	455.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRX3`	Arabidopsis thaliana	sp\|Q0WRX3\|SCP40_ARATH Serine carboxypeptidase-like 40	50.700%	Swiss-Prot	High
`O82229`	Arabidopsis thaliana	sp\|O82229\|SCP23_ARATH Putative serine carboxypeptidase-like 23	49.700%	Swiss-Prot	Medium
`Q9SFB5`	Arabidopsis thaliana	sp\|Q9SFB5\|SCP27_ARATH Serine carboxypeptidase-like 27	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card