TkA02G039870 | RubberDandelionOmics

Gene overview

TkA02G039870

Reference: TK1151 Chr: Chr02 Coordinates: 10051944-10065121 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2919 bp · TkA02G039870|TK1151|cDNA

ATGGACGGAAACAACAGCCAAGAAGTAATTCAACCACCAATTGGACAGAACCCACCAGCACAAATGGCGGGAATACAAATACCACCATTAGTTGCTCCGCAAGACCATAACAACAACGATAATGAAGGAAACAACAACATGGCAGGACCACCACCAGTTGTTCCGCAACCACCACTGAACAGAAACAATCAAGGGTTCAATGGTGGAAATGGGCAAAATTGGGGGAACGGTGGTAACCGACAGAATCAGCAAAACCAAGG...

CDS

Download CDS FASTA

2919 bp · TkA02G039870|TK1151|CDS

ATGGACGGAAACAACAGCCAAGAAGTAATTCAACCACCAATTGGACAGAACCCACCAGCACAAATGGCGGGAATACAAATACCACCATTAGTTGCTCCGCAAGACCATAACAACAACGATAATGAAGGAAACAACAACATGGCAGGACCACCACCAGTTGTTCCGCAACCACCACTGAACAGAAACAATCAAGGGTTCAATGGTGGAAATGGGCAAAATTGGGGGAACGGTGGTAACCGACAGAATCAGCAAAACCAAGG...

Protein

Download Protein FASTA

972 aa · TkA02G039870|TK1151|PROTEIN

MDGNNSQEVIQPPIGQNPPAQMAGIQIPPLVAPQDHNNNDNEGNNNMAGPPPVVPQPPLNRNNQGFNGGNGQNWGNGGNRQNQQNQGPNRGNGQGFNHNDVIVEDWYDDNESEDGKQGWNQNNNGGSGIFPVNQQNGNQNGNFNNNNNRNNQGYYDENYNEVNHFPNLYFPQPNRQSVASHFQPGEYDDASPILYPNGNEHHVEIRPQLIGILPVFRDMTHQAMINASSGGTIMMQDSEAAWRFLEQLSNGSKTNYSSKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G039870`
TK1151 ID	TkA02G039870
OH-1004 ID	LXL04_037994
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.800
Protein coverage (%)	TK1151 83.745 / OH-1004 43.952 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G039870`
Location	Chr02:10051944-10065121 (-)
Description	Similar to TY3B-I: Transposon Ty3-I Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037994` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function
KEGG gene cross-reference	sce:YGR109W-B sce:YIL082W-A spo:2538755 spo:2541833 spo:2541991 spo:3361422 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.748

Rank 1 · TkA02G039870 · TK1151

Nucleus0.333

Rank 2 · TkA02G039870 · TK1151

Cell membrane0.071

Rank 3 · TkA02G039870 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA02G039870 · TK1151

Mitochondrion0.045

Rank 5 · TkA02G039870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16526CLZ279-301 aa

PF00098zf-CCHC314-328 aa

PF16526CLZ405-455 aa

PF30863PRO_PEG10-RTL1657-756 aa

PF13975gag-asp_proteas657-742 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G039870	`PF16526`	CLZ	279	301	0.29	12.3
TkA02G039870	`PF00098`	zf-CCHC	314	328	0.064	14.1
TkA02G039870	`PF16526`	CLZ	405	455	0.29	12.3
TkA02G039870	`PF30863`	PRO_PEG10-RTL1	657	756	0.031	15.4
TkA02G039870	`PF13975`	gag-asp_proteas	657	742	0.059	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card