TkA02G038180 | RubberDandelionOmics

Gene overview

TkA02G038180

Reference: TK1151 Chr: Chr02 Coordinates: 9634170-9641765 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2324 bp · TkA02G038180|TK1151|cDNA

TATAAACATCTTTTGCTTTCATTACTTCACGAGCTTTAATTTAAACAATTTCAAATTTCAACTCAATAGTTTTTTTAACACTTATTTACCGAATTTGCGGTATATATAGTTATATACATCCAGAAATGGAGACATATACACTTGCAAACACCAGATTTCTCGTGACAGAGCTCACAAGCCAATAAATCACCACCGTTCACGCATTTCCACAGATTAAAATTCACAGCTTTTACAACTCTATTTTTTGCATAATCACCCAA...

CDS

Download CDS FASTA

1596 bp · TkA02G038180|TK1151|CDS

ATGGATTTCTGTTGCTCAACACCAAAAAACAGTACCCATTTGCTGAAATTAAATGGAGGTTTAAGAAATCGGGACGATGATGGGTTTTTGAGTGGGGAGAAGATCAGAGGGAGTTTAAACGGCACCGTTTGGGTTAACCATTTGCGAAAAAAGTTGAGTTTTCAAAAGCGAAATAGCAAAATTACAAAACCTGGTGTTGCTTACTCTGTTATCACGTCAAATAATGGCCATGAAACCATGGTTGAGAAACTTGCGCCACC...

Protein

Download Protein FASTA

531 aa · TkA02G038180|TK1151|PROTEIN

MDFCCSTPKNSTHLLKLNGGLRNRDDDGFLSGEKIRGSLNGTVWVNHLRKKLSFQKRNSKITKPGVAYSVITSNNGHETMVEKLAPPIFERRRVNPKNVAAIILGGGAGTHLFPLTSKTATPAVPVGGCYRLIDIPMSNCINSTINKIFVLTQFNSASLNRHIARTYYGNGVNFGDGFVEVLAATQTPGEAGMNWFQGTADAVRQFTWVFEDAKNKDIEDILILSGDHLYRMDYLNLLQNHMDRDADITVSCVPVGESRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G038180`
TK1151 ID	TkA02G038180
OH-1004 ID	LXL04_017496
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G038180

Location Chr02:9634170-9641765 (+)

Description Similar to AGPS1: Glucose-1-phosphate adenylyltransferase large subunit 1 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39210`	This protein plays a role in synthesis of starch.	No verified direct reference in this release
`At2g21590`	This protein plays a role in synthesis of starch.	No verified direct reference in this release
`At1g27680`	This protein plays a role in synthesis of starch.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010170 glucose-1-phosphate adenylyltransferase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008878 glucose-1-phosphate adenylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G27680

ath:AT2G21590

ath:AT4G39210

bvg:104889614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.962

Rank 1 · TkA02G038180 · TK1151

Mitochondrion0.055

Rank 2 · TkA02G038180 · TK1151

Cytoplasm0.034

Rank 3 · TkA02G038180 · TK1151

Peroxisome0.025

Rank 4 · TkA02G038180 · TK1151

Nucleus0.018

Rank 5 · TkA02G038180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483NTP_transferase101-377 aa

PF25247LbH_GLGC396-530 aa

PF24894Hexapep_GlmU397-458 aa

PF25087GMPPB_C404-450 aa

PF25084LbH_EIF2B405-449 aa

PF00132Hexapep410-419 aa

PF24894Hexapep_GlmU456-494 aa

PF25084LbH_EIF2B470-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G038180	`PF00483`	NTP_transferase	101	377	1.4e-69	235.1
TkA02G038180	`PF25247`	LbH_GLGC	396	530	3.2e-54	183.2
TkA02G038180	`PF24894`	Hexapep_GlmU	397	458	1.2e-08	35.7
TkA02G038180	`PF25087`	GMPPB_C	404	450	1.5e-06	28.6
TkA02G038180	`PF25084`	LbH_EIF2B	405	449	4.8e-06	27.2
TkA02G038180	`PF00132`	Hexapep	410	419	0.02	15.3
TkA02G038180	`PF24894`	Hexapep_GlmU	456	494	1.2e-08	35.7
TkA02G038180	`PF25084`	LbH_EIF2B	470	496	4.8e-06	27.2
TkA02G038180	`PF00132`	Hexapep	471	494	0.02	15.3
TkA02G038180	`PF25087`	GMPPB_C	476	530	1.5e-06	28.6
TkA02G038180	`PF00132`	Hexapep	518	531	0.02	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55231`	Arabidopsis thaliana	sp\|P55231\|GLGL3_ARATH Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic	67.400%	Swiss-Prot	High
`Q9SIK1`	Arabidopsis thaliana	sp\|Q9SIK1\|GLGL4_ARATH Probable glucose-1-phosphate adenylyltransferase large subunit, chloroplastic	72.600%	Swiss-Prot	High
`P55230`	Arabidopsis thaliana	sp\|P55230\|GLGL2_ARATH Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card