Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1277 bp · TkA02G037110|TK1151|cDNA
AAATGAAGGGTGACACGCAGATGCAGGTGACTCACGTTTCTCGTCAACGGAGGTCGACGAGATGCACATGGTGTAACATCATTTTCAAATTTACGCGAAGTCTTGATTTTTTGTTATTGGAAAGCTCGAATTGAGATGCAGATGCACTTTGATTTGTAAATTACAATATAATAAAGCTAAAAGTTCCTGATCACCGACCTTCAAACCTAGAAATTGTCATCGATATTCAGAGAGGAGGTTCTTCTTCTTATTATTTTTGT...
1467 bp · TkA02G037110|TK1151|CDS
ATGGAAAAATGTTCTCCGGAAGATGACGATCCAGAGAAAAAGCAGGAGAAAAAGGAGGATGTTGCTGCAGATCCAGAATTCTTTAGCTGCATGCTTCAGCCGCATTCCACGAACTCCGATCCTATTTACATCGGAACCCGCCGTCTTCTACTATTTCGCAAGGCTCGATCCGGTACTCTTCACCGGAAGGATTGGAGATGCAATGGTAAAGGCTATGTGGCTTATCGCAATTTTATCACCACGCTGGAGAATCGAATGAA...
Protein
Download Protein FASTA488 aa · TkA02G037110|TK1151|PROTEIN
MEKCSPEDDDPEKKQEKKEDVAADPEFFSCMLQPHSTNSDPIYIGTRRLLLFRKARSGTLHRKDWRCNGKGYVAYRNFITTLENRMKLQSPSHLSSPGTSGRWAPSSGPASLTHDMDTWSLSKSESQTLSRTNSILSNISEKTDQSRRKTEPAYSFVGMHCIFDECKSMVTVIKFGHMSSDILAFGANDGTLTVCSVSEPPSVMKKLSGHSKDVTDFDFTMNNHYIASSSLDKTVRVWDIPKGLCIRVIYGIAPQLCIRF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G037110 |
|---|---|
| TK1151 ID | TkA02G037110 |
| OH-1004 ID | LXL04_017520 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 98.566 / OH-1004 94.314Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G037110 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:9308450-9312227 (+) | |||||||||
| Description | Similar to WDR13: WD repeat-containing protein 13 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:1904691 negative regulation of type B pancreatic cell proliferation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0034451 centriolar satellite Cellular Component GO:0048188 Set1C/COMPASS complex Cellular Component GO:0042393 histone binding Molecular Function GO:1990841 promoter-specific chromatin binding Molecular Function | |||||||||
| KEGG gene cross-reference | hsa:54554 hsa:64743 mmu:73447 pon:100171581 ptr:449584 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17475Binary_toxB_2114-170 aaPF25173Beta-prop_WDR3_1st160-280 aaPF24805EIF3I161-241 aaPF23775Beta-prop_RIG_2nd163-271 aaPF23414Beta-prop_EML_2164-243 aaPF24782WD40_MABP1-WDR62_2nd164-319 aaPF25175Beta-prop_WDR5166-473 aaPF23389Beta-prop_WDR19_1st166-239 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G037110 | PF17475 | Binary_toxB_2 | 114 | 170 | 0.21 | 12.0 |
| TkA02G037110 | PF25173 | Beta-prop_WDR3_1st | 160 | 280 | 9.5e-28 | 97.9 |
| TkA02G037110 | PF24805 | EIF3I | 161 | 241 | 1e-09 | 38.7 |
| TkA02G037110 | PF23775 | Beta-prop_RIG_2nd | 163 | 271 | 8.9e-10 | 39.2 |
| TkA02G037110 | PF23414 | Beta-prop_EML_2 | 164 | 243 | 1.9e-24 | 87.2 |
| TkA02G037110 | PF24782 | WD40_MABP1-WDR62_2nd | 164 | 319 | 2.5e-07 | 30.7 |
| TkA02G037110 | PF25175 | Beta-prop_WDR5 | 166 | 473 | 3e-30 | 106.2 |
| TkA02G037110 | PF23389 | Beta-prop_WDR19_1st | 166 | 239 | 1.5e-06 | 28.2 |
| TkA02G037110 | PF25171 | Beta-prop_WDR36-Utp21_1st | 167 | 238 | 2.7e-09 | 37.6 |
| TkA02G037110 | PF24817 | WD40_WDHD1_1st | 168 | 335 | 7.5e-26 | 91.7 |
| TkA02G037110 | PF23098 | Beta-prop_NOL10_N | 168 | 244 | 1.7e-09 | 38.0 |
| TkA02G037110 | PF23409 | Beta-prop_EML | 168 | 239 | 2e-06 | 28.2 |
| TkA02G037110 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 169 | 286 | 1.4e-16 | 61.4 |
| TkA02G037110 | PF24814 | WD40_Prp19 | 170 | 248 | 2.5e-22 | 80.0 |
| TkA02G037110 | PF23393 | Beta-prop_WDR90_POC16_2nd | 170 | 230 | 5.7e-10 | 39.6 |
| TkA02G037110 | PF29037 | DSE1_N | 170 | 242 | 4.8e-08 | 33.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.