TkA02G035170 | RubberDandelionOmics

Gene overview

TkA02G035170

Reference: TK1151 Chr: Chr02 Coordinates: 8724378-8729070 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2140 bp · TkA02G035170|TK1151|cDNA

CTCTCTCTTCCCCTCTCTCTCTCTCAAGACTCCATTCATGGTTTCCAAAAATATAGTCTGGGGGATGATGAGATGATGAGGTTATAGAATATTCTCTTGACCTTCTTCCCTCCCTTACATCCTGCCATTTTTTTGTCGCTGGTCGGCATTTGACAAGGGCGTTAAGATTCGGCACTGCTAACAAACATTTGCAATTATGAGTGAGTCCGGACCTGAACGCCCCGTTCGACCCAGTATGGAAAAAATCGACTTGGAAGAGG...

CDS

Download CDS FASTA

1209 bp · TkA02G035170|TK1151|CDS

ATGAGTGAGTCCGGACCTGAACGCCCCGTTCGACCCAGTATGGAAAAAATCGACTTGGAAGAGGAGGACAAGAAGGCTAGGCGTAACTCTCTGAAACAGAGGGCAATCAATGCCTCAAACAAATTTAGGACCTCGTTCTCCAAGAAAAGCAGGAGGAACAGTAAAGTCATGTCTGTGGTTGTTGAGGATGAACATGATGCAGAGGATTTAAAGGCAGTTGAAGCTTTACGTCAAGCTTTGATCCAGGAAGACATGCTACC...

Protein

Download Protein FASTA

402 aa · TkA02G035170|TK1151|PROTEIN

MSESGPERPVRPSMEKIDLEEEDKKARRNSLKQRAINASNKFRTSFSKKSRRNSKVMSVVVEDEHDAEDLKAVEALRQALIQEDMLPAKHDDYHMLLRFLKARNYELDKAKLMWTNMITWRKEYGADTIMEEYEFKEKEEVLQYYPQGHHGVDKDGRPIYIERLGMVDAAKLLQATTLERYIKYHVMEFERTFVDKFPACSIAAKRHVDQSTTILDVQNVGLKSMNKSARELIQSLQNIDGNNYPETLCRMYIINAGSGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G035170`
TK1151 ID	TkA02G035170
OH-1004 ID	LXL04_017504
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 76.617 / OH-1004 52.650 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G035170

Location Chr02:8724378-8729070 (-)

Description Similar to SFH3: Phosphatidylinositol/phosphatidylcholine transfer protein SFH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21540`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release
`At4g36490`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At2g18180`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g34580`	Required for transport of secretory proteins from the Golgi complex (By similarity).	The Arabidopsis COW1 gene encodes a phosphatidylinositol transfer protein essential for root hair tip growth.2004 · DOI: 10.1111/j.1365-313x.2004.02245.x OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice.2013 · DOI: 10.1007/s11103-013-0033-4 The COW1 locus of arabidopsis acts after RHD2, and in parallel with RHD3 and TIP1, to determine the shape, rate of elongation, and number of root hairs produced from each site of hair formation.1997 · DOI: 10.1104/pp.115.3.981

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017504 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0009908 flower development Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0015031 protein transport Biological Process

GO:0048767 root hair elongation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G18180

ath:AT2G21540

ath:AT4G34580

ath:AT4G36490

ath:AT4G39180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.332

Rank 1 · TkA02G035170 · TK1151

Cell membrane0.213

Rank 2 · TkA02G035170 · TK1151

Endoplasmic reticulum0.193

Rank 3 · TkA02G035170 · TK1151

Mitochondrion0.159

Rank 4 · TkA02G035170 · TK1151

Nucleus0.139

Rank 5 · TkA02G035170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23020PEX14-like_2nd17-63 aa

PF11397GlcNAc47-156 aa

PF23020PEX14-like_2nd53-117 aa

PF28528UBA_Pinta71-123 aa

PF03765CRAL_TRIO_N89-116 aa

PF00650CRAL_TRIO143-305 aa

PF23020PEX14-like_2nd204-232 aa

PF13716CRAL_TRIO_2208-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G035170	`PF23020`	PEX14-like_2nd	17	63	0.56	11.2
TkA02G035170	`PF11397`	GlcNAc	47	156	0.081	13.1
TkA02G035170	`PF23020`	PEX14-like_2nd	53	117	0.56	11.2
TkA02G035170	`PF28528`	UBA_Pinta	71	123	5.7e-05	24.0
TkA02G035170	`PF03765`	CRAL_TRIO_N	89	116	0.00011	23.0
TkA02G035170	`PF00650`	CRAL_TRIO	143	305	1.5e-30	106.8
TkA02G035170	`PF23020`	PEX14-like_2nd	204	232	0.56	11.2
TkA02G035170	`PF13716`	CRAL_TRIO_2	208	306	9.7e-06	26.7
TkA02G035170	`PF13716`	CRAL_TRIO_2	323	349	9.7e-06	26.7
TkA02G035170	`PF00650`	CRAL_TRIO	347	376	1.5e-30	106.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZE9`	Arabidopsis thaliana	sp\|Q93ZE9\|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3	70.800%	Swiss-Prot	High
`F4JVA9`	Arabidopsis thaliana	sp\|F4JVA9\|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	69.600%	Swiss-Prot	High
`Q94A34`	Arabidopsis thaliana	sp\|Q94A34\|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12	70.100%	Swiss-Prot	High
`Q9SI13`	Arabidopsis thaliana	sp\|Q9SI13\|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10	74.700%	Swiss-Prot	High
`F4JLE5`	Arabidopsis thaliana	sp\|F4JLE5\|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card