TkA02G031900 | RubberDandelionOmics

Gene overview

TkA02G031900

Reference: TK1151 Chr: Chr02 Coordinates: 7722888-7731945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · TkA02G031900|TK1151|cDNA

AAGCAGCCGCCGCCACCGCAACCGCCAGCAGTAATCACCACCGCCCCAACATGATATCACCATCACCACCACCACCACCACAAATTGAGTTAGTCATTGATCATTCTACCATCCTCAAATCGGACGGCGGCCACGATGGCATTTTAATCGTAATCAAAGACCTGGTTTTTCCGGTGTTAGCACGGTGTCATGCAGGCTACTTTCGCATCACCCTCTCCCTTTGCTGTCAAACCCTTCTCTGGAAAACCCTCAAAGACCCG...

CDS

Download CDS FASTA

1191 bp · TkA02G031900|TK1151|CDS

ATGATATCACCATCACCACCACCACCACCACAAATTGAGTTAGTCATTGATCATTCTACCATCCTCAAATCGGACGGCGGCCACGATGGCATTTTAATCGTAATCAAAGACCTGGTTTTTCCGGTGTTAGCACGGTGTCATGCAGGCTACTTTCGCATCACCCTCTCCCTTTGCTGTCAAACCCTTCTCTGGAAAACCCTCAAAGACCCGCCGGAAAACGCTCACGCTTACCGGAGAATGCTCGGCGTGTTGCCCACCAC...

Protein

Download Protein FASTA

396 aa · TkA02G031900|TK1151|PROTEIN

MISPSPPPPPQIELVIDHSTILKSDGGHDGILIVIKDLVFPVLARCHAGYFRITLSLCCQTLLWKTLKDPPENAHAYRRMLGVLPTTAFLLLWSLSLLILASLSILYILRCALFSDMVKNEFLNHIGVNYLFAPSISWLLLLQSAPFFKPKTIYYLLLWWVFVVPIFVLDVKIYGQWFTKGKRILSIVANPASQLSVVGNFVGARAAAQMGWKESAMVMFALGMIHYLVVFVTLYQRLSENNLPTMLRPVMFLFIAAPSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G031900`
TK1151 ID	TkA02G031900
OH-1004 ID	LXL04_017556
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G031900

Location Chr02:7722888-7731945 (-)

Description Similar to SLAH1: S-type anion channel SLAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62280`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g62262`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g12480`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	CO2 regulator SLAC1 and its homologues are essential for anion homeostasis in plant cells.2008 · DOI: 10.1038/nature06720 SLAC1 is required for plant guard cell S-type anion channel function in stomatal signalling.2008 · DOI: 10.1038/nature06608 Ozone-triggered rapid stomatal response involves the production of reactive oxygen species, and is controlled by SLAC1 and OST1.2010 · DOI: 10.1111/j.1365-313x.2010.04159.x Stomatal action directly feeds back on leaf turgor: new insights into the regulation of the plant water status from non-invasive pressure probe measurements.2010 · DOI: 10.1111/j.1365-313x.2010.04213.x S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050 Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514
`At5g24030`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050
`At4g27970`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017556 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0006821 chloride transport Biological Process

GO:0006873 intracellular monoatomic ion homeostasis Biological Process

GO:0009270 response to humidity Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G12480

ath:AT1G62262

ath:AT1G62280

ath:AT4G27970

ath:AT5G24030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.786

Rank 1 · TkA02G031900 · TK1151

Endoplasmic reticulum0.120

Rank 2 · TkA02G031900 · TK1151

Cytoplasm0.071

Rank 3 · TkA02G031900 · TK1151

Lysosome / Vacuole0.068

Rank 4 · TkA02G031900 · TK1151

Nucleus0.034

Rank 5 · TkA02G031900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03595SLAC146-356 aa

PF07332Phage_holin_3_687-103 aa

PF07332Phage_holin_3_6215-237 aa

PF07332Phage_holin_3_6216-234 aa

PF09003Arm-DNA-bind_1294-316 aa

PF07332Phage_holin_3_6318-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G031900	`PF03595`	SLAC1	46	356	1.9e-42	146.3
TkA02G031900	`PF07332`	Phage_holin_3_6	87	103	0.68	10.7
TkA02G031900	`PF07332`	Phage_holin_3_6	215	237	0.68	10.7
TkA02G031900	`PF07332`	Phage_holin_3_6	216	234	0.68	10.7
TkA02G031900	`PF09003`	Arm-DNA-bind_1	294	316	0.38	11.5
TkA02G031900	`PF07332`	Phage_holin_3_6	318	358	0.68	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E930`	Arabidopsis thaliana	sp\|Q5E930\|SLAH1_ARATH S-type anion channel SLAH1	56.100%	Swiss-Prot	High
`A8MRV9`	Arabidopsis thaliana	sp\|A8MRV9\|SLAH4_ARATH S-type anion channel SLAH4	54.000%	Swiss-Prot	High
`Q9LD83`	Arabidopsis thaliana	sp\|Q9LD83\|SLAC1_ARATH Guard cell S-type anion channel SLAC1	42.900%	Swiss-Prot	Medium
`Q9FLV9`	Arabidopsis thaliana	sp\|Q9FLV9\|SLAH3_ARATH S-type anion channel SLAH3	39.600%	Swiss-Prot	Medium
`Q9ASQ7`	Arabidopsis thaliana	sp\|Q9ASQ7\|SLAH2_ARATH S-type anion channel SLAH2	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card