TkA02G030740 | RubberDandelionOmics

Gene overview

TkA02G030740

Reference: TK1151 Chr: Chr02 Coordinates: 7453460-7455756 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · TkA02G030740|TK1151|cDNA

GTGCAAGTGACCCCCTTACTCCCTTCTTCAATCCGCCCCTGAGTCCACCAACATCCGTATTGACAGATTAGATCCATGGCTACTTCCGAGATCAAGAAGATTCAAATTCAAAGGGGCGATATCATATTTGATGCATATGTGGTCGGGAAAGAACATGCACCTGGAATCGTGGTTCTTCACGAGTGGTGGGGAGTTGATTTTGAGATCAAGAATCATGCACTCAAAATCTCCAAATTTAACAACGGCTACAAAACGATTAT...

CDS

Download CDS FASTA

717 bp · TkA02G030740|TK1151|CDS

ATGGCTACTTCCGAGATCAAGAAGATTCAAATTCAAAGGGGCGATATCATATTTGATGCATATGTGGTCGGGAAAGAACATGCACCTGGAATCGTGGTTCTTCACGAGTGGTGGGGAGTTGATTTTGAGATCAAGAATCATGCACTCAAAATCTCCAAATTTAACAACGGCTACAAAACGATTATACCCGATTTGTACCGTGGAAAAGTTGCTTGTGATGCCTTAGAAGCGCAACATTTGATGGATTGTCTTGATTGGCC...

Protein

Download Protein FASTA

238 aa · TkA02G030740|TK1151|PROTEIN

MATSEIKKIQIQRGDIIFDAYVVGKEHAPGIVVLHEWWGVDFEIKNHALKISKFNNGYKTIIPDLYRGKVACDALEAQHLMDCLDWPCALKDIQASIHWLKCNGSRKVGVTGFGLGGALAIASAVLVPEVDTAVSFYGVPPCELVDPTNIKAPVQAHFGERDNIVGFSDIKTAKVLESKLKASGKTYEVHVHHGVSHAFMNTSPEGEERRKSLGMFDELTGTADVAWSRFIAWIDRYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G030740`
TK1151 ID	TkA02G030740
OH-1004 ID	LXL04_017564
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 100.000 / OH-1004 82.699 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G030740`
Location	Chr02:7453460-7455756 (+)
Description	Similar to usf: Protein usf
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017564` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008806 carboxymethylenebutenolidase activity Molecular Function GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	aae:aq_1997 mea:Mex_1p1735 sso:SSO2087 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.735

Rank 1 · TkA02G030740 · TK1151

Nucleus0.373

Rank 2 · TkA02G030740 · TK1151

Mitochondrion0.070

Rank 3 · TkA02G030740 · TK1151

Peroxisome0.060

Rank 4 · TkA02G030740 · TK1151

Cell membrane0.053

Rank 5 · TkA02G030740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01738DLH18-237 aa

PF01764Lipase_367-127 aa

PF07859Abhydrolase_386-129 aa

PF05448AXE1105-137 aa

PF02230Abhydrolase_2106-202 aa

PF07859Abhydrolase_3175-200 aa

PF01764Lipase_3185-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G030740	`PF01738`	DLH	18	237	4.9e-47	161.0
TkA02G030740	`PF01764`	Lipase_3	67	127	0.013	16.1
TkA02G030740	`PF07859`	Abhydrolase_3	86	129	0.0018	18.8
TkA02G030740	`PF05448`	AXE1	105	137	0.16	11.5
TkA02G030740	`PF02230`	Abhydrolase_2	106	202	0.0019	18.8
TkA02G030740	`PF07859`	Abhydrolase_3	175	200	0.0018	18.8
TkA02G030740	`PF01764`	Lipase_3	185	200	0.013	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card