Gene Card
Gene overview
cDNA / CDS / Protein Sequences
402 bp · TkA02G027420|TK1151|cDNA
GTGGAGTACTCTTTGTTCGGGGCCCCCGGAATAACCCATTTGTCTTTGCCGCTGGTAAGGGTTCTTCCGTCCAAAATCTGGGTAAGGTTATTTGCCTCCTCTCGTTCTCTCCCTCCTCGTATGTCGCGTCTTCTCTTCCAATCTTCTATGTTCATAATGAGGCGCTGTTTGACCGAAGCCTGTTTTTCCTCTTCTAGGGCGTATAGGCGAGGGAACAGGTTCTTCAAAATTCCATTCGCGAGCCATTTGTCCTCCCAAAA...
402 bp · TkA02G027420|TK1151|CDS
GTGGAGTACTCTTTGTTCGGGGCCCCCGGAATAACCCATTTGTCTTTGCCGCTGGTAAGGGTTCTTCCGTCCAAAATCTGGGTAAGGTTATTTGCCTCCTCTCGTTCTCTCCCTCCTCGTATGTCGCGTCTTCTCTTCCAATCTTCTATGTTCATAATGAGGCGCTGTTTGACCGAAGCCTGTTTTTCCTCTTCTAGGGCGTATAGGCGAGGGAACAGGTTCTTCAAAATTCCATTCGCGAGCCATTTGTCCTCCCAAAA...
Protein
Download Protein FASTA133 aa · TkA02G027420|TK1151|PROTEIN
VEYSLFGAPGITHLSLPLVRVLPSKIWVRLFASSRSLPPRMSRLLFQSSMFIMRRCLTEACFSSSRAYRRGNRFFKIPFASHLSSQNLVESPSPMRTCKISVKLRNNDLSFWILRRILFQMHECIFPVSISLI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G027420 |
|---|---|
| TK1151 ID | TkA02G027420 |
| OH-1004 ID | LXL04_025863 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 41.000 |
| Protein coverage (%) | TK1151 91.729 / OH-1004 4.475Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G027420 |
|---|---|
| Location | Chr02:6648754-6649155 (-) |
| Description | Similar to ZFYVE26: Zinc finger FYVE domain-containing protein 26 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0007040 lysosome organization Biological Process GO:0032465 regulation of cytokinesis Biological Process GO:1905037 autophagosome organization Biological Process GO:0005764 lysosome Cellular Component GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0005813 centrosome Cellular Component GO:0030496 midbody Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0019901 protein kinase binding Molecular Function |
| KEGG gene cross-reference | mmu:211978 rno:314265 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.