TkA02G022460 | RubberDandelionOmics

Gene overview

TkA02G022460

Reference: TK1151 Chr: Chr02 Coordinates: 5326982-5327952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

805 bp · TkA02G022460|TK1151|cDNA

CACGTTTCCATTTCTCCACAAATTACAAGATACATTGACATTATTTAAAGCAAGCATCTCATTGGAGTTTATCATATCAAACTAACACAAATAAACATGGCTCCCTCTGCAAAAGTTTTGATGATCTTTATATCTTTTTTCTTTTTCTTTTTATCAGGCACTAATGCTGGTTGCGGTCCCTGCAATCCATGTGGTCCTTGCAATCCGTGTGGTCCTTGCAATCCGTGCGGTCCATGCAACCCTTGCGGTCCATGCAATCC...

CDS

Download CDS FASTA

543 bp · TkA02G022460|TK1151|CDS

ATGGCTCCCTCTGCAAAAGTTTTGATGATCTTTATATCTTTTTTCTTTTTCTTTTTATCAGGCACTAATGCTGGTTGCGGTCCCTGCAATCCATGTGGTCCTTGCAATCCGTGTGGTCCTTGCAATCCGTGCGGTCCATGCAACCCTTGCGGTCCATGCAATCCTTGTGGTCCATGCAATCCGTGCGGTCCTTGCAATCCTTGCGGACCCGCACAAGGTGGATCAGTTGACTTGACATCAGCTAATTTTGATTCCCAGGT...

Protein

Download Protein FASTA

180 aa · TkA02G022460|TK1151|PROTEIN

MAPSAKVLMIFISFFFFFLSGTNAGCGPCNPCGPCNPCGPCNPCGPCNPCGPCNPCGPCNPCGPCNPCGPAQGGSVDLTSANFDSQVINNCDFWIVTFAAPWCGYAKQLQPEWQKAAQNMQGKAKFGWVNCDVEKEVCGKYKIRGYPTVIGFPAKNKGSPVEYLGPLTAPDIQDFINGQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G022460`
TK1151 ID	TkA02G022460
OH-1004 ID	LXL04_017594
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G022460

Location Chr02:5326982-5327952 (+)

Description Similar to PDIL2-2: Protein disulfide-isomerase like 2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60640`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	Protein disulfide isomerase-2 of Arabidopsis mediates protein folding and localizes to both the secretory pathway and nucleus, where it interacts with maternal effect embryo arrest factor.2011 · DOI: 10.1007/s10059-011-0150-3

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017594 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003756 protein disulfide isomerase activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04980

ath:AT2G32920

dosa:Os09g0451500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.772

Rank 1 · TkA02G022460 · TK1151

Cytoplasm0.118

Rank 2 · TkA02G022460 · TK1151

Lysosome / Vacuole0.101

Rank 3 · TkA02G022460 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA02G022460 · TK1151

Cell membrane0.048

Rank 5 · TkA02G022460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04756OST3_OST68-21 aa

PF03940MSSP26-74 aa

PF25616PhiKZ_gp3541-97 aa

PF00085Thioredoxin47-47 aa

PF00085Thioredoxin76-177 aa

PF20207PedC-like78-158 aa

PF26959Thioredoxin-like_N78-123 aa

PF14595Thioredoxin_994-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G022460	`PF04756`	OST3_OST6	8	21	0.027	14.6
TkA02G022460	`PF03940`	MSSP	26	74	1.9	8.9
TkA02G022460	`PF25616`	PhiKZ_gp35	41	97	0.15	11.8
TkA02G022460	`PF00085`	Thioredoxin	47	47	8.3e-22	77.9
TkA02G022460	`PF00085`	Thioredoxin	76	177	8.3e-22	77.9
TkA02G022460	`PF20207`	PedC-like	78	158	0.03	15.0
TkA02G022460	`PF26959`	Thioredoxin-like_N	78	123	0.31	11.6
TkA02G022460	`PF14595`	Thioredoxin_9	94	146	0.13	12.8
TkA02G022460	`PF13098`	Thioredoxin_2	95	154	0.011	16.8
TkA02G022460	`PF04756`	OST3_OST6	103	159	0.027	14.6
TkA02G022460	`PF03940`	MSSP	103	104	1.9	8.9
TkA02G022460	`PF13848`	Thioredoxin_6	110	177	0.028	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF55`	Arabidopsis thaliana	sp\|Q9FF55\|PDI14_ARATH Protein disulfide isomerase-like 1-4	32.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card