TkA02G020140 | RubberDandelionOmics

Gene overview

TkA02G020140

Reference: TK1151 Chr: Chr02 Coordinates: 4723832-4725070 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1147 bp · TkA02G020140|TK1151|cDNA

CGGACTTATACTCATCCTAATCCGTCAATCTTATTAAATTCCATATATAACCCCCATCACTCTTCATCATCAACACACACCCTCAACAAACTACCATCCCTTCAAAACCAAACAAAGAAATGGCAAGCTCTGTAATCCAACAGTCAGCATTCGCTGGCCAACAGGCCTTGAAGCCACAGAACGAGCTTGTCAGAAAGACCGGCAACTTCAATGGCGGCACCATCACCATGCGCCGCACAGTCAAAAGTGCACCACAAAGC...

CDS

Download CDS FASTA

798 bp · TkA02G020140|TK1151|CDS

ATGGCAAGCTCTGTAATCCAACAGTCAGCATTCGCTGGCCAACAGGCCTTGAAGCCACAGAACGAGCTTGTCAGAAAGACCGGCAACTTCAATGGCGGCACCATCACCATGCGCCGCACAGTCAAAAGTGCACCACAAAGCATCTGGTACGGACCAGACCGTCCAAAGTATTTGGGTCCATTCTCCGAGCAAACCCCATCATACTTGACCGGTGAATTCCCCGGTGACTACGGTTGGGACACTGCTGGACTCTCGGCTGA...

Protein

Download Protein FASTA

265 aa · TkA02G020140|TK1151|PROTEIN

MASSVIQQSAFAGQQALKPQNELVRKTGNFNGGTITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G020140`
TK1151 ID	TkA02G020140
OH-1004 ID	LXL04_017636
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 86.319 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G020140

Location Chr02:4723832-4725070 (+)

Description Similar to CAB36: Chlorophyll a-b binding protein 36, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05100`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017636 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009269 response to desiccation Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009645 response to low light intensity stimulus Biological Process

GO:0009765 photosynthesis, light harvesting Biological Process

GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process

GO:0009769 photosynthesis, light harvesting in photosystem II Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

KEGG gene cross-reference

ath:AT2G05100

ghi:107954948

sly:543975

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · TkA02G020140 · TK1151

Mitochondrion0.029

Rank 2 · TkA02G020140 · TK1151

Cytoplasm0.014

Rank 3 · TkA02G020140 · TK1151

Nucleus0.009

Rank 4 · TkA02G020140 · TK1151

Cell membrane0.008

Rank 5 · TkA02G020140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504Chloroa_b-bind66-231 aa

PF31213HliA98-123 aa

PF31213HliA213-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G020140	`PF00504`	Chloroa_b-bind	66	231	9.2e-50	170.0
TkA02G020140	`PF31213`	HliA	98	123	0.0021	18.7
TkA02G020140	`PF31213`	HliA	213	240	0.0021	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHR7`	Arabidopsis thaliana	sp\|Q9SHR7\|CB21_ARATH Chlorophyll a-b binding protein 2.1, chloroplastic	89.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card