RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G017960
Reference: TK1151 Chr: Chr02 Coordinates: 4232020-4235876 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3471 bp · TkA02G017960|TK1151|cDNA

CTAAATTTAGGTCTCGGATATTTTGTGTCCATCCACAACCATTCAGTGGGATCTGGGCCGGATCCCATCCCATTCCTAAATTCTCCATTCATGTGTCATTTTGGCGGACTCTTAAGATAATATTGAAGAAGTTTGTTAACACTGTGGATACTCTGCTTTCTGAGTTAAAAATTGAGTTAAAATTGAAGAGAAGTTATAGAGTTGGATTGAAAATGCTACACTCGCCAAGATTTCTCTGAAGGGTATAAACCTTAAAATCA...

CDS

Download CDS FASTA

2601 bp · TkA02G017960|TK1151|CDS

ATGAGATCCTGCATAAGAGATGCTGAAAGAAAACAATTGAAGAGTGAACTGGTTGAAACATGGGTGAGACAAGTGCGGGAAGTTGCCCAGAAAATCGAAGATGTGTTAGACGAGTATGTTTACTATCAAGATTTGGGAGAAGAAAAAAAGGGGTTCAAGAATTTGATGCAAGACATCATCAAAGTTCCAATGCACATGAGCAGAAAACGTAAAATATCTATGAAGCTTCAAAAGCTTAAAGCCGAGGTTCGTGAAGTTTG...

Protein

Download Protein FASTA

866 aa · TkA02G017960|TK1151|PROTEIN

MRSCIRDAERKQLKSELVETWVRQVREVAQKIEDVLDEYVYYQDLGEEKKGFKNLMQDIIKVPMHMSRKRKISMKLQKLKAEVREVCERRKKYTFDEKTDDWRGRNASIDWWQRQEMFVDEDEIVGMDDNKNKLMEWLMEDDPRRMVISVVGMGGLGKTTLVTKVYNDQAIQRCFDCWAWVSVSQTKGVDELLRSMIKKLFGRKRETLPLDLGLMSYRELVEMLIDYLHKKRYVIILDDVWNILLWSRIRSAFPENGLGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G017960
TK1151 IDTkA02G017960
OH-1004 IDLXL04_017658
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 95.585
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G017960
LocationChr02:4232020-4235876 (-)
DescriptionSimilar to RPM1: Disease resistance protein RPM1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g07040 Disease resistance (R) protein that specifically recognizes the AvrRpm1 type III effector avirulence protein from Pseudomonas syringae.
The Arabidopsis thaliana RPM1 disease resistance gene product is a peripheral plasma membrane protein that is degraded coincident with the hypersensitive response.1998 · DOI: 10.1073/pnas.95.26.15849
At5g35450 Disease resistance protein. No verified direct reference in this release
At5g43470 Disease resistance protein.
Intragenic recombination and diversifying selection contribute to the evolution of downy mildew resistance at the RPP8 locus of Arabidopsis.1998 · DOI: 10.1105/tpc.10.11.1861
At3g50950 CC-NB-LRR receptor-like protein required for recognition of pathogenic bacteria type III effectors (T3E) such as Pseudomonas syringae HopZ1a and HopF2a and Xanthomonas campestris pv. campestris (Xcc) XopAC/AvrAC; this recognition requires ZED1-related kinases (e.g. PBL2, ZRK3 and ZED1/ZRK5).
Allele-specific virulence attenuation of the Pseudomonas syringae HopZ1a type III effector via the Arabidopsis ZAR1 resistance protein.2010 · DOI: 10.1371/journal.pgen.1000894
At1g59620 Probable disease resistance protein. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017658 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002230 positive regulation of defense response to virus by host Biological Process
GO:0002239 response to oomycetes Biological Process
GO:0006952 defense response Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009611 response to wounding Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009637 response to blue light Biological Process
GO:0009646 response to absence of light Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0051607 defense response to virus Biological Process
GO:0051707 response to other organism Biological Process
GO:0071446 cellular response to salicylic acid stimulus Biological Process
KEGG gene cross-reference
ath:AT1G53350
ath:AT3G07040
ath:AT5G35450
ath:AT5G43470
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.606
Rank 1 · TkA02G017960 · TK1151
Cytoplasm0.279
Rank 2 · TkA02G017960 · TK1151
Nucleus0.156
Rank 3 · TkA02G017960 · TK1151
Endoplasmic reticulum0.057
Rank 4 · TkA02G017960 · TK1151
Plastid0.028
Rank 5 · TkA02G017960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18052Rx_N1-51 aa
PF00931NB-ARC51-89 aa
PF28416Kizuna_N59-93 aa
PF00931NB-ARC128-301 aa
PF13481AAA_25135-165 aa
PF25201nSTAND6143-207 aa
PF13401AAA_22145-240 aa
PF13191AAA_16145-240 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G017960PF18052Rx_N1512.1e-1247.7
TkA02G017960PF00931NB-ARC51895.5e-47160.3
TkA02G017960PF28416Kizuna_N59932.09.1
TkA02G017960PF00931NB-ARC1283015.5e-47160.3
TkA02G017960PF13481AAA_251351650.2311.8
TkA02G017960PF25201nSTAND61432070.002118.8
TkA02G017960PF13401AAA_221452405.4e-0524.2
TkA02G017960PF13191AAA_161452407e-0524.1
TkA02G017960PF13173AAA_141452650.03614.8
TkA02G017960PF13671AAA_331472570.04314.9
TkA02G017960PF05729NACHT1472000.1113.0
TkA02G017960PF23559WHD_DRP3924633e-2279.1
TkA02G017960PF13401AAA_224274705.4e-0524.2
TkA02G017960PF29857DUF85924605210.212.2
TkA02G017960PF24758LRR_At5g563704866050.02614.9
TkA02G017960PF23598LRR_145208251.5e-49169.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39214Arabidopsis thalianasp|Q39214|RPM1_ARATH Disease resistance protein RPM137.100%Swiss-ProtMedium
Q9FJB5Arabidopsis thalianasp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 325.900%Swiss-ProtLow
Q8W4J9Arabidopsis thalianasp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP825.000%Swiss-ProtLow
Q38834Arabidopsis thalianasp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 432.800%Swiss-ProtMedium
Q9LQ54Arabidopsis thalianasp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g5962026.000%Swiss-ProtLow

JBrowse

View in Genome Browser