TkA02G017510 | RubberDandelionOmics

Gene overview

TkA02G017510

Reference: TK1151 Chr: Chr02 Coordinates: 4120334-4121554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · TkA02G017510|TK1151|cDNA

ATGAAGGTGTCGGCGCTTTCTCTCTCCTTCCTCTTCCTCCTGTCTATATCCGCCACCGTTCACGCCCATAACATCACCCGGATCCTCGCCAAGCACCCCGAGTTTTCCACTTTCAACCACTACCTCACCATCACTCATCTCGCCAATGAAATCAACCGCCGTCAGACCATCACCGTCTGTGCCGTTGACAATGCCGCAATGTCATCATTGATCTCGAAAGGCTTATCTATTCAGACCATAAAAAATGTTCTCTCCCTCCA...

CDS

Download CDS FASTA

1167 bp · TkA02G017510|TK1151|CDS

ATGAAGGTGTCGGCGCTTTCTCTCTCCTTCCTCTTCCTCCTGTCTATATCCGCCACCGTTCACGCCCATAACATCACCCGGATCCTCGCCAAGCACCCCGAGTTTTCCACTTTCAACCACTACCTCACCATCACTCATCTCGCCAATGAAATCAACCGCCGTCAGACCATCACCGTCTGTGCCGTTGACAATGCCGCAATGTCATCATTGATCTCGAAAGGCTTATCTATTCAGACCATAAAAAATGTTCTCTCCCTCCA...

Protein

Download Protein FASTA

388 aa · TkA02G017510|TK1151|PROTEIN

MKVSALSLSFLFLLSISATVHAHNITRILAKHPEFSTFNHYLTITHLANEINRRQTITVCAVDNAAMSSLISKGLSIQTIKNVLSLHVFADYFGSKKLHQVTKGSTSTATMYQATGEAPGTAGYVHITDIKGGKVRFTPEDNPSQTDTTYVKSILEMPYNISVIQISAILQSPEAEAPTAAPDLNLTSLLQRDGCQAFYDLLTSSGAIGTFLSSADGGVTVFCPGDDAIAAFAPKYKNLTASEKTSLLLYHGVPVYNSMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G017510`
TK1151 ID	TkA02G017510
OH-1004 ID	LXL04_017659
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.800
Protein coverage (%)	TK1151 98.969 / OH-1004 98.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G017510

Location Chr02:4120334-4121554 (-)

Description Similar to FLA2: Fasciclin-like arabinogalactan protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12730`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At5g55730`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g60900`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g45470`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g46550`	May be a cell surface adhesion protein that is required for normal cell expansion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT2G24450

ath:AT2G45470

ath:AT3G60900

ath:AT4G12730

ath:AT5G55730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.430

Rank 1 · TkA02G017510 · TK1151

Extracellular0.341

Rank 2 · TkA02G017510 · TK1151

Endoplasmic reticulum0.123

Rank 3 · TkA02G017510 · TK1151

Cytoplasm0.108

Rank 4 · TkA02G017510 · TK1151

Lysosome / Vacuole0.050

Rank 5 · TkA02G017510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469Fasciclin33-111 aa

PF02469Fasciclin194-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G017510	`PF02469`	Fasciclin	33	111	2.4e-25	89.8
TkA02G017510	`PF02469`	Fasciclin	194	324	2.4e-25	89.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU13`	Arabidopsis thaliana	sp\|Q9SU13\|FLA2_ARATH Fasciclin-like arabinogalactan protein 2	62.700%	Swiss-Prot	High
`Q9FM65`	Arabidopsis thaliana	sp\|Q9FM65\|FLA1_ARATH Fasciclin-like arabinogalactan protein 1	58.100%	Swiss-Prot	High
`Q9LZX4`	Arabidopsis thaliana	sp\|Q9LZX4\|FLA10_ARATH Fasciclin-like arabinogalactan protein 10	48.400%	Swiss-Prot	Medium
`O22126`	Arabidopsis thaliana	sp\|O22126\|FLA8_ARATH Fasciclin-like arabinogalactan protein 8	46.000%	Swiss-Prot	Medium
`Q9SNC3`	Arabidopsis thaliana	sp\|Q9SNC3\|FLA4_ARATH Fasciclin-like arabinogalactan protein 4	29.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card