Gene Card
Gene overview
cDNA / CDS / Protein Sequences
336 bp · TkA02G017480|TK1151|cDNA
ATGTTGAGCTGTGCCCCAAACTACATTGAAAAGGCATTGGTGGACATCCATTCCCAGTGCACAGCAAAACTTCAGACAGTTGCACCTGGCAATTCACTCCAAATGTTGTTTGTCATTATTCCTGATGTCAAAGGAAGTTACCCAAGAAATCAAATGGTGATCATGGCTGGTGGAGATTCTGTGAAAGATATGACAAACAAGTTTGACAAGTTGCAGAAGTTTGAAGAGCAGGACTTTCGAAGATGGCAGAAGAAGATGCA...
336 bp · TkA02G017480|TK1151|CDS
ATGTTGAGCTGTGCCCCAAACTACATTGAAAAGGCATTGGTGGACATCCATTCCCAGTGCACAGCAAAACTTCAGACAGTTGCACCTGGCAATTCACTCCAAATGTTGTTTGTCATTATTCCTGATGTCAAAGGAAGTTACCCAAGAAATCAAATGGTGATCATGGCTGGTGGAGATTCTGTGAAAGATATGACAAACAAGTTTGACAAGTTGCAGAAGTTTGAAGAGCAGGACTTTCGAAGATGGCAGAAGAAGATGCA...
Protein
Download Protein FASTA111 aa · TkA02G017480|TK1151|PROTEIN
MLSCAPNYIEKALVDIHSQCTAKLQTVAPGNSLQMLFVIIPDVKGSYPRNQMVIMAGGDSVKDMTNKFDKLQKFEEQDFRRWQKKMHFLLTTLKVVYVLSTPMPEFAEDET
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G017480 |
|---|---|
| TK1151 ID | TkA02G017480 |
| OH-1004 ID | LXL04_032978 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 92.500 |
| Protein coverage (%) | TK1151 47.748 / OH-1004 5.579Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G017480 |
|---|---|
| Location | Chr02:4113563-4115145 (-) |
| Description | Similar to AGO1: Protein argonaute 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006417 regulation of translation Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0007143 female meiotic nuclear division Biological Process GO:0009561 megagametogenesis Biological Process GO:0009615 response to virus Biological Process GO:0009616 RNAi-mediated antiviral immune response Biological Process GO:0009733 response to auxin Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009850 auxin metabolic process Biological Process GO:0009955 adaxial/abaxial pattern specification Biological Process GO:0009965 leaf morphogenesis Biological Process |
| KEGG gene cross-reference | ath:AT1G48410 ath:AT2G27880 dosa:Os02g0672200 dosa:Os03g0800200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05753TRAP_beta17-51 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G017480 | PF05753 | TRAP_beta | 17 | 51 | 0.053 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.