TkA02G013980 | RubberDandelionOmics

Gene overview

TkA02G013980

Reference: TK1151 Chr: Chr02 Coordinates: 3176260-3176930 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA02G013980|TK1151|cDNA

CCCTACTTTCAGAAGAAGGCAGGAAAAGAAAAAGCAGAATCGGTTGTTGTTCAGAAGAAGAAGAAGAAGAAGAAGAGATCGGATTGCCTTACTGCTGAACAAAAGAAAGACGATGCGTACAAAAAGAAGACTCCAGATAACCCATGGATTCCTCCCCGCTCCTGTCATAATCTCATTCAGGAGGATCATATCCATGATCCCTGGCGGATTCTCACTATATGTCTACTTCTAAATCAAACACAGGGTTTGCAGGTGAAACG...

CDS

Download CDS FASTA

579 bp · TkA02G013980|TK1151|CDS

CCCTACTTTCAGAAGAAGGCAGGAAAAGAAAAAGCAGAATCGGTTGTTGTTCAGAAGAAGAAGAAGAAGAAGAAGAGATCGGATTGCCTTACTGCTGAACAAAAGAAAGACGATGCGTACAAAAAGAAGACTCCAGATAACCCATGGATTCCTCCCCGCTCCTGTCATAATCTCATTCAGGAGGATCATATCCATGATCCCTGGCGGATTCTCACTATATGTCTACTTCTAAATCAAACACAGGGTTTGCAGGTGAAACG...

Protein

Download Protein FASTA

192 aa · TkA02G013980|TK1151|PROTEIN

PYFQKKAGKEKAESVVVQKKKKKKKRSDCLTAEQKKDDAYKKKTPDNPWIPPRSCHNLIQEDHIHDPWRILTICLLLNQTQGLQVKRVISDFFTLCPDAKTATQVPVDAIQVLIKPLGLQKKRSRMIQILSEQILDDEWTHVTQLYGVGKYAADAYAIFCTGQWTRVTPKDHMLNRYWEWLHQNKEALQLVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G013980`
TK1151 ID	TkA02G013980
OH-1004 ID	LXL04_017686
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.958 / OH-1004 26.207 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G013980

Location Chr02:3176260-3176930 (-)

Description Similar to MBD4L: Methyl-CpG-binding domain protein 4-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07930`	Monofunctional DNA glycosylase targeting U:G and T:G mispairs.	Molecular characterization of a putative plant homolog of MBD4 DNA glycosylase.2013 · DOI: 10.1016/j.dnarep.2013.08.002 Expression and function of AtMBD4L, the single gene encoding the nuclear DNA glycosylase MBD4L in Arabidopsis.2015 · DOI: 10.1016/j.plantsci.2015.03.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017686 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0009314 response to radiation Biological Process

GO:0009408 response to heat Biological Process

GO:0032355 response to estradiol Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0045008 depyrimidination Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G07930

hsa:8930

mmu:17193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.787

Rank 1 · TkA02G013980 · TK1151

Mitochondrion0.216

Rank 2 · TkA02G013980 · TK1151

Cytoplasm0.135

Rank 3 · TkA02G013980 · TK1151

Cell membrane0.019

Rank 4 · TkA02G013980 · TK1151

Extracellular0.009

Rank 5 · TkA02G013980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00730HhH-GPD75-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G013980	`PF00730`	HhH-GPD	75	186	4.1e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0IGK1`	Arabidopsis thaliana	sp\|Q0IGK1\|MBD4L_ARATH Methyl-CpG-binding domain protein 4-like protein	68.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card