TkA02G013070 | RubberDandelionOmics

Gene overview

TkA02G013070

Reference: TK1151 Chr: Chr02 Coordinates: 2953425-2953915 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA02G013070|TK1151|cDNA

ATGATGTGGAAGCTGAATTTTTTTGAGGGATTTTGTTGTATAGCTCTAAACAACGACTATATGCTGTATTATATATGTCCAATGCACACTCTTTTTAGTCTAATGGTGTATGGAGCACTTGCAATTGGAATGTGGGAGGTTCCTGGTGTCTTTGACTTAATTTGGGGCCCTTTTGCTTTCCTCTTAGGTTACAGTGATCCAGCAAAACCAGATCTTCCTAGATTGCTCGAGTGGCATTTCAGATCTGGGCTTGACAGAGT...

CDS

Download CDS FASTA

315 bp · TkA02G013070|TK1151|CDS

ATGATGTGGAAGCTGAATTTTTTTGAGGGATTTTGTTGTATAGCTCTAAACAACGACTATATGCTGTATTATATATGTCCAATGCACACTCTTTTTAGTCTAATGGTGTATGGAGCACTTGCAATTGGAATGTGGGAGGTTCCTGGTGTCTTTGACTTAATTTGGGGCCCTTTTGCTTTCCTCTTAGGTTACAGTGATCCAGCAAAACCAGATCTTCCTAGATTGCTCGAGTGGCATTTCAGATCTGGGCTTGACAGAGT...

Protein

Download Protein FASTA

104 aa · TkA02G013070|TK1151|PROTEIN

MMWKLNFFEGFCCIALNNDYMLYYICPMHTLFSLMVYGALAIGMWEVPGVFDLIWGPFAFLLGYSDPAKPDLPRLLEWHFRSGLDRVWIKSAEFGSNLQKYLQP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G013070`
TK1151 ID	TkA02G013070
OH-1004 ID	LXL04_007725
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 49.289 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G013070

Location Chr02:2953425-2953915 (+)

Description Similar to RWA4: Protein REDUCED WALL ACETYLATION 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29890`	Probable O-acetyltransferase involved in the acetylation of xylan during secondary wall biosynthesis.	No verified direct reference in this release
`At5g46340`	Probable O-acetyltransferase involved in the acetylation of xylan during secondary wall biosynthesis.	The four Arabidopsis reduced wall acetylation genes are expressed in secondary wall-containing cells and required for the acetylation of xylan.2011 · DOI: 10.1093/pcp/pcr075
`At2g34410`	Probable O-acetyltransferase involved in the acetylation of xylan during secondary wall biosynthesis.	No verified direct reference in this release
`At3g06550`	Probable O-acetyltransferase involved in the acetylation of cell wall polymers (both pectic and nonpectic polysaccharides) and of xylan during secondary wall biosynthesis.	Loss-of-function mutation of REDUCED WALL ACETYLATION2 in Arabidopsis leads to reduced cell wall acetylation and increased resistance to Botrytis cinerea.2011 · DOI: 10.1104/pp.110.168989 Reduced Wall Acetylation proteins play vital and distinct roles in cell wall O-acetylation in Arabidopsis.2013 · DOI: 10.1104/pp.113.225193

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007725 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005976 polysaccharide metabolic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G29890

ath:AT2G34410

ath:AT3G06550

ath:AT5G46340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.210

Rank 1 · TkA02G013070 · TK1151

Plastid0.198

Rank 2 · TkA02G013070 · TK1151

Endoplasmic reticulum0.154

Rank 3 · TkA02G013070 · TK1151

Cytoplasm0.135

Rank 4 · TkA02G013070 · TK1151

Golgi apparatus0.111

Rank 5 · TkA02G013070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07779Cas1_AcylT1-42 aa

PF07779Cas1_AcylT76-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G013070	`PF07779`	Cas1_AcylT	1	42	0.0009	18.9
TkA02G013070	`PF07779`	Cas1_AcylT	76	88	0.0009	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXG3`	Arabidopsis thaliana	sp\|Q9FXG3\|RWA4_ARATH Protein REDUCED WALL ACETYLATION 4	64.600%	Swiss-Prot	High
`Q8L7C8`	Arabidopsis thaliana	sp\|Q8L7C8\|RWA1_ARATH Protein REDUCED WALL ACETYLATION 1	61.900%	Swiss-Prot	High
`Q66GQ5`	Arabidopsis thaliana	sp\|Q66GQ5\|RWA3_ARATH Protein REDUCED WALL ACETYLATION 3	60.200%	Swiss-Prot	High
`Q0WW17`	Arabidopsis thaliana	sp\|Q0WW17\|RWA2_ARATH Protein REDUCED WALL ACETYLATION 2	58.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card