TkA02G005320 | RubberDandelionOmics

Gene overview

TkA02G005320

Reference: TK1151 Chr: Chr02 Coordinates: 1131373-1132701 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA02G005320|TK1151|cDNA

ATGAAGGATCTCCCGGAAGACCATCCACACAGCTGGAAGCAACAAGCTAAGATCCATTGCGCTTACTGCAACGGCGGTTACAATCAAGAACAGAAGAGGATATTGGGGAAGTTGATTAAGGATCCAACTTTCGCTTTACCATACTGGAACTGGGACAACCCCACCGGAATGGTGCTTCCCGCCATGTTTGAAACCGACGGCAAACGGAACCCTATCTTTGACCCTTACAGGAATGCCACACACCTCCCACCAACTATCTT...

CDS

Download CDS FASTA

1122 bp · TkA02G005320|TK1151|CDS

ATGAAGGATCTCCCGGAAGACCATCCACACAGCTGGAAGCAACAAGCTAAGATCCATTGCGCTTACTGCAACGGCGGTTACAATCAAGAACAGAAGAGGATATTGGGGAAGTTGATTAAGGATCCAACTTTCGCTTTACCATACTGGAACTGGGACAACCCCACCGGAATGGTGCTTCCCGCCATGTTTGAAACCGACGGCAAACGGAACCCTATCTTTGACCCTTACAGGAATGCCACACACCTCCCACCAACTATCTT...

Protein

Download Protein FASTA

373 aa · TkA02G005320|TK1151|PROTEIN

MKDLPEDHPHSWKQQAKIHCAYCNGGYNQEQKRILGKLIKDPTFALPYWNWDNPTGMVLPAMFETDGKRNPIFDPYRNATHLPPTIFEVGYNGSDSGASCIDQISANLSLMYRQMITSAPDTTTFFGGEFVAGDDPLNKEFNVAGSIEAGVHTAAHRWVGDPRMANNEDMGNFYSAGYDPLFYVHHANVDRMWKIWKDLGIKGHNEPTSDDWLNASYVFYDENEELVRVYNKDCVNIKRMGFDYERSEIPWLHSRPVAHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G005320`
TK1151 ID	TkA02G005320
OH-1004 ID	LXL04_039724
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 78.284 / OH-1004 63.673 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G005320`
Location	Chr02:1131373-1132701 (+)
Description	Similar to co-2: Polyphenol oxidase II, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039724` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0046148 pigment biosynthetic process Biological Process GO:1901708 (+)-3'-hydroxylarreatricin biosynthetic process Biological Process GO:1901709 (+)-larreatricin metabolic process Biological Process GO:0009543 chloroplast thylakoid lumen Cellular Component GO:0004097 catechol oxidase activity Molecular Function GO:0005507 copper ion binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	mdm:103446446 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.674

Rank 1 · TkA02G005320 · TK1151

Cytoplasm0.127

Rank 2 · TkA02G005320 · TK1151

Lysosome / Vacuole0.057

Rank 3 · TkA02G005320 · TK1151

Mitochondrion0.036

Rank 4 · TkA02G005320 · TK1151

Nucleus0.035

Rank 5 · TkA02G005320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00264Tyrosinase10-28 aa

PF00264Tyrosinase35-198 aa

PF12142PPO1_DWL208-256 aa

PF12143PPO1_KFDV282-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G005320	`PF00264`	Tyrosinase	10	28	7.5e-22	79.5
TkA02G005320	`PF00264`	Tyrosinase	35	198	7.5e-22	79.5
TkA02G005320	`PF12142`	PPO1_DWL	208	256	3.5e-18	65.8
TkA02G005320	`PF12143`	PPO1_KFDV	282	369	8.2e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card