TkA01G640380 | RubberDandelionOmics

Gene overview

TkA01G640380

Reference: TK1151 Chr: Chr01 Coordinates: 162063010-162065069 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2002 bp · TkA01G640380|TK1151|cDNA

GTTGACAACGTTCTCCAGGTCCCACTCATTATCTCCACTCTCCAAAATCCCCTTCATCTTCCTTCTCCATCTCCATCTCCATCTCCATCCATTCCTAACTCGAAAACTCCCCACCAAAATCCGCAGAGGAACTCAGTAAAATCAATTTCACTGATGAAGAACAGCTCCCCATGATTTTCCAATGCAAAAACCCATCTGAAATGAAATATTTCTATCGCCATTTCATCATTCAGTTTGCTCTGTATTTGCTTCTCTCTTCC...

CDS

Download CDS FASTA

1518 bp · TkA01G640380|TK1151|CDS

ATGGAACTCGCCGCCGGTAAACCCAGCTTCCTCCGAAACGTTGTTGTTCGATTTTTGTTGTTTTCCCTTCTCATCGTCGGCGTCCGATTTGCTTACGTTATTACAATCAGAGGTGAATCGTGCCGCACCGGCGATGATTTCTGTTTCTTCTCTTCAATCTCGCCGGAAAATCAAGATCTTGTCACTTCTGCCGGAGGACATCTTGACACTTCTTCGTCTGTTACCCTCAACCCTATCTCCGCCGCCACACCAGAGGTCCA...

Protein

Download Protein FASTA

505 aa · TkA01G640380|TK1151|PROTEIN

MELAAGKPSFLRNVVVRFLLFSLLIVGVRFAYVITIRGESCRTGDDFCFFSSISPENQDLVTSAGGHLDTSSSVTLNPISAATPEVHKRVMFYITAFQDLIVDGFLSTKSKSLCVETPVGEDVYALREIGVDDSVGIYKKASKPLVINGLGHRHPFKDNTFDFIFSGNGALDRSDKAAEFAAEVGRTLKPEGYAVVHTSSKDTYSFNSFIRLFNCCNFVHSRHMDGFDPDMPHIHEIVMKKKIDIKIREKTDSTRTNRCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G640380`
TK1151 ID	TkA01G640380
OH-1004 ID	LXL04_000039
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 94.653 / OH-1004 72.097 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G640380`
Location	Chr01:162063010-162065069 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000039` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.724

Rank 1 · TkA01G640380 · TK1151

Extracellular0.086

Rank 2 · TkA01G640380 · TK1151

Cell membrane0.072

Rank 3 · TkA01G640380 · TK1151

Endoplasmic reticulum0.064

Rank 4 · TkA01G640380 · TK1151

Cytoplasm0.048

Rank 5 · TkA01G640380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08241Methyltransf_11130-195 aa

PF13649Methyltransf_25147-192 aa

PF04604L_biotic_typeA194-216 aa

PF25276DUF7870278-369 aa

PF05050Methyltransf_21313-468 aa

PF13649Methyltransf_25331-351 aa

PF25276DUF7870412-505 aa

PF04604L_biotic_typeA462-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G640380	`PF08241`	Methyltransf_11	130	195	8.5e-06	27.0
TkA01G640380	`PF13649`	Methyltransf_25	147	192	0.014	16.8
TkA01G640380	`PF04604`	L_biotic_typeA	194	216	3.2	8.4
TkA01G640380	`PF25276`	DUF7870	278	369	2.4e-33	116.4
TkA01G640380	`PF05050`	Methyltransf_21	313	468	0.00014	22.8
TkA01G640380	`PF13649`	Methyltransf_25	331	351	0.014	16.8
TkA01G640380	`PF25276`	DUF7870	412	505	2.4e-33	116.4
TkA01G640380	`PF04604`	L_biotic_typeA	462	470	3.2	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card