TkA01G640100 | RubberDandelionOmics

Gene overview

TkA01G640100

Reference: TK1151 Chr: Chr01 Coordinates: 162022784-162023740 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · TkA01G640100|TK1151|cDNA

ATGGCATCTTTACTAAACCACAGGGACCATTTCTGTAACTTTGTCAAAGTTCTATCCACTTCATATTTCATACTTATTATACTTAATCTGGCATCTCTCAGGATAAGCACTGCATGTCTCTTGGTTATTCTCTCTCAAGTCTACAGGCCTAGCTTTGTTTTCTTGTCATTGCTTGCTTTGGATATTGCAAGCCATTGGATGCACATGTACAGTACTTTCTTGGTTGGTAAATCTAATCATAAAGACGTCAAAGACAGCAG...

CDS

Download CDS FASTA

462 bp · TkA01G640100|TK1151|CDS

ATGGCATCTTTACTAAACCACAGGGACCATTTCTGTAACTTTGTCAAAGTTCTATCCACTTCATATTTCATACTTATTATACTTAATCTGGCATCTCTCAGGATAAGCACTGCATGTCTCTTGGTTATTCTCTCTCAAGTCTACAGGCCTAGCTTTGTTTTCTTGTCATTGCTTGCTTTGGATATTGCAAGCCATTGGATGCACATGTACAGTACTTTCTTGGTTGGTAAATCTAATCATAAAGACGTCAAAGACAGCAG...

Protein

Download Protein FASTA

153 aa · TkA01G640100|TK1151|PROTEIN

MASLLNHRDHFCNFVKVLSTSYFILIILNLASLRISTACLLVILSQVYRPSFVFLSLLALDIASHWMHMYSTFLVGKSNHKDVKDSSSWLFKLYYGNKIFMGYCCIACEVNYYLFLLFLLPFISLLLILVIVVKNMTIFCPRVQLILQLGADF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G640100`
TK1151 ID	TkA01G640100
OH-1004 ID	LXL04_033538
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G640100

Location Chr01:162022784-162023740 (-)

Description Similar to PIS2: Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38570`	Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction.	No verified direct reference in this release
`At1g68000`	Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033538 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0046341 CDP-diacylglycerol metabolic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003881 CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G68000

ath:AT4G38570

cal:CAALFM_C405210WA

hsa:10423

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.271

Rank 1 · TkA01G640100 · TK1151

Nucleus0.254

Rank 2 · TkA01G640100 · TK1151

Endoplasmic reticulum0.216

Rank 3 · TkA01G640100 · TK1151

Mitochondrion0.196

Rank 4 · TkA01G640100 · TK1151

Golgi apparatus0.104

Rank 5 · TkA01G640100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUK6`	Arabidopsis thaliana	sp\|Q8GUK6\|PIS2_ARATH Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2	73.600%	Swiss-Prot	Medium
`Q8LBA6`	Arabidopsis thaliana	sp\|Q8LBA6\|PIS1_ARATH CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1	74.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card