TkA01G636920 | RubberDandelionOmics

Gene overview

TkA01G636920

Reference: TK1151 Chr: Chr01 Coordinates: 161117681-161121893 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2773 bp · TkA01G636920|TK1151|cDNA

TTTCTACCTTCCGAAATCAGCCGTTTGAGATATCATGTCGTTGCAAAACACAGCCTACCAACCCATTTTGTTCACAACTTCTTTAAAAGTCCTTTCTCTCTCTCTTACCGTTCTTCTAGGTTCCCTAAATCTCTCTTCGGTCTACAAGATTTCAACACTTCTGGAATTCAATTTTTTTTTGCTCAATAATCACAAATTGGCATTAACCCAAAAAACGTGGGCACAGATTTTTTCAAAGTCAAGGGCCAATTTTCTTTCTG...

CDS

Download CDS FASTA

891 bp · TkA01G636920|TK1151|CDS

ATGGATCCATCAGGTCGATATGGACGTTTCAAGGAAATTTTGGGGAAAGGAGCAACGAAATCGGTTTACAAGGCATTCGATGAGGTTTTAGCAATGGAAGTGGCTTGGAACCAGGTGAAACTCAACGACATTTTCCGATCACCAGAAGAACTTCAACGCCTATATTCAGAAGTCCATCTCCTCAAAAACCTAAATCACAACTCCATAATGCGATTTCACACGTCATGGATTGACGTCGATAGAAGGACATTTAACTTCAT...

Protein

Download Protein FASTA

296 aa · TkA01G636920|TK1151|PROTEIN

MDPSGRYGRFKEILGKGATKSVYKAFDEVLAMEVAWNQVKLNDIFRSPEELQRLYSEVHLLKNLNHNSIMRFHTSWIDVDRRTFNFITEMFTAGSLREYRQKYKRVHILAIKDWARQILQGLTYLHSHNPPVIHRDLKCDNIFINGHLGQVKIGDLGLAATLCESQHAHSVIGTPEFMAPEMYEEDYNELVDIYSFGMCMLEMLTSEYPYTECSNPAQIYKKVTSGKLPKAFYEIKDPEAQAFVGKCLRNVSSRPSAKDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G636920`
TK1151 ID	TkA01G636920
OH-1004 ID	LXL04_000073
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 50.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G636920

Location Chr01:161117681-161121893 (+)

Description Similar to WNK4: Probable serine/threonine-protein kinase WNK4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51630`	Regulates flowering time by modulating the photoperiod pathway.	The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At5g58350`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YMV6`	Probable serine/threonine-protein kinase WNK1.	No verified direct reference in this release
`Os07g0572800`	Probable serine/threonine-protein kinase WNK1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000073 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G22420

ath:AT5G28080

ath:AT5G58350

dosa:Os07g0572800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · TkA01G636920 · TK1151

Nucleus0.458

Rank 2 · TkA01G636920 · TK1151

Cell membrane0.089

Rank 3 · TkA01G636920 · TK1151

Mitochondrion0.053

Rank 4 · TkA01G636920 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA01G636920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr10-261 aa

PF00069Pkinase11-266 aa

PF17667Pkinase_fungal120-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G636920	`PF07714`	PK_Tyr_Ser-Thr	10	261	1.1e-32	114.2
TkA01G636920	`PF00069`	Pkinase	11	266	1.5e-48	166.2
TkA01G636920	`PF17667`	Pkinase_fungal	120	196	0.00098	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCU5`	Arabidopsis thaliana	sp\|Q9SCU5\|WNK5_ARATH Probable serine/threonine-protein kinase WNK5	80.000%	Swiss-Prot	High
`Q9LVL5`	Arabidopsis thaliana	sp\|Q9LVL5\|WNK4_ARATH Probable serine/threonine-protein kinase WNK4	66.900%	Swiss-Prot	High
`Q9STK6`	Arabidopsis thaliana	sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3	65.500%	Swiss-Prot	High
`A2YMV6`	Oryza sativa subsp. indica	sp\|A2YMV6\|WNK1_ORYSI Probable serine/threonine-protein kinase WNK1	67.000%	Swiss-Prot	High
`Q0D598`	Oryza sativa subsp. japonica	sp\|Q0D598\|WNK1_ORYSJ Probable serine/threonine-protein kinase WNK1	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card