TkA01G636020 | RubberDandelionOmics

Gene overview

TkA01G636020

Reference: TK1151 Chr: Chr01 Coordinates: 160907310-160909342 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1217 bp · TkA01G636020|TK1151|cDNA

TAAAGTTGAGGCTTTGAATTGCGATGTCCAAAACTGCAGGGCGTTTTCTACCATTTACCTAAAAACAAAAAACAAGAAACCAGGCGAAACAACAGTATCCAAAACCCCTCCTTATCCAAGCATCGAGTTCTTTAGTTCAACTGGGTTTTGGACCTCGTAGATGATGATTTCTGGGTGAAAAACGACAGCAGTTCCGATTGGTTACACACACCCGCTTACAAATAATCGTTGTAGCGAAACCCCAATAATATGGCGAGTAT...

CDS

Download CDS FASTA

705 bp · TkA01G636020|TK1151|CDS

ATGGCGAGTATGATGGCATTCAAGTTGTCGCCTTTCTCATCCAGTGTTCCACCAACGACTGCACATTCTTCAATTTCATTCTCCTCAAAGAAATTCTTTCTTCCAATGAAGTTTTCATCACGCCGTCCTACATTTCCAAGAATCTATGCATATTCTAGCAATGATATTAAGGTGGGTTCTAACATTGAGGTAGATGGATCTCCATGGAAAGTTATAGAGTTTCTTCATGTGAAGCCTGGTAAAGGGGCTGCTTATGTGAG...

Protein

Download Protein FASTA

234 aa · TkA01G636020|TK1151|PROTEIN

MASMMAFKLSPFSSSVPPTTAHSSISFSSKKFFLPMKFSSRRPTFPRIYAYSSNDIKVGSNIEVDGSPWKVIEFLHVKPGKGAAYVRTTLRNYVTGNSVEKTFRAGSKIEQAEISKETKQFTYKDGPQFVFMDNTTYEEVRLNESDMGDKTKWLKEGMDCILLFWKGKVIDFELPIQVKVTIIESDPGVKGDTAQGGTKPATVETGAVVNVPLFVERGQVIVVDTRTGQYVSRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G636020`
TK1151 ID	TkA01G636020
OH-1004 ID	LXL04_000080
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G636020`
Location	Chr01:160907310-160909342 (-)
Description	Similar to efp: Elongation factor P (Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000080` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043043 peptide biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0003746 translation elongation factor activity Molecular Function
KEGG gene cross-reference	cyp:PCC8801_0547 mar:MAE_56930 syc:syc1545_d syf:Synpcc7942_2565 syp:SYNPCC7002_A0053 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA01G636020 · TK1151

Mitochondrion0.061

Rank 2 · TkA01G636020 · TK1151

Nucleus0.013

Rank 3 · TkA01G636020 · TK1151

Cytoplasm0.010

Rank 4 · TkA01G636020 · TK1151

Cell membrane0.006

Rank 5 · TkA01G636020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21485IF5A-like_N50-101 aa

PF08207EFP_N52-109 aa

PF27197YomX_C52-75 aa

PF09285Elong-fact-P_C56-65 aa

PF27197YomX_C115-144 aa

PF01132EFP116-171 aa

PF09285Elong-fact-P_C178-233 aa

PF27197YomX_C204-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G636020	`PF21485`	IF5A-like_N	50	101	0.11	13.1
TkA01G636020	`PF08207`	EFP_N	52	109	7.6e-24	84.1
TkA01G636020	`PF27197`	YomX_C	52	75	0.0056	17.3
TkA01G636020	`PF09285`	Elong-fact-P_C	56	65	1e-24	86.7
TkA01G636020	`PF27197`	YomX_C	115	144	0.0056	17.3
TkA01G636020	`PF01132`	EFP	116	171	2.3e-22	79.3
TkA01G636020	`PF09285`	Elong-fact-P_C	178	233	1e-24	86.7
TkA01G636020	`PF27197`	YomX_C	204	220	0.0056	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card