TkA01G634700 | RubberDandelionOmics

Gene overview

TkA01G634700

Reference: TK1151 Chr: Chr01 Coordinates: 160572085-160572553 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA01G634700|TK1151|cDNA

CTTTTATTGCTTAGAACGACAATGAAACGTCCTTTGCCACAATCTTATTTTAAACCCTCTAAACTCATTCACAAGTTGAGAGATCCAATATTGCTTTGCCTGTTTCTTTTGGTAGTTTCTTTGGATGTTATTGAGTCGGGCTCCATTGTTAAGACACTACCAGGTTTCCCGGGTGATCTTCCATTTACATTGGAAACTGGTTACATTGGAGTAGGAAAATCCGATGATGTGCAGTTATTTTACTATTTTTTTGAGTTTGA...

CDS

Download CDS FASTA

351 bp · TkA01G634700|TK1151|CDS

ATGAAACGTCCTTTGCCACAATCTTATTTTAAACCCTCTAAACTCATTCACAAGTTGAGAGATCCAATATTGCTTTGCCTGTTTCTTTTGGTAGTTTCTTTGGATGTTATTGAGTCGGGCTCCATTGTTAAGACACTACCAGGTTTCCCGGGTGATCTTCCATTTACATTGGAAACTGGTTACATTGGAGTAGGAAAATCCGATGATGTGCAGTTATTTTACTATTTTTTTGAGTTTGAAGGGAACCCAAAGAACGACCC...

Protein

Download Protein FASTA

117 aa · TkA01G634700|TK1151|PROTEIN

MKRPLPQSYFKPSKLIHKLRDPILLCLFLLVVSLDVIESGSIVKTLPGFPGDLPFTLETGYIGVGKSDDVQLFYYFFEFEGNPKNDPLMLWLTGGPGASVLIAIMQEIGISIYMISN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G634700`
TK1151 ID	TkA01G634700
OH-1004 ID	LXL04_000086
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.000
Protein coverage (%)	TK1151 91.453 / OH-1004 32.951 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G634700

Location Chr01:160572085-160572553 (+)

Description Similar to SCPL18: Serine carboxypeptidase-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36180`	Probable carboxypeptidase.	No verified direct reference in this release
`At1g73310`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g22920`	Probable carboxypeptidase.	No verified direct reference in this release
`At1g73300`	Probable carboxypeptidase.	No verified direct reference in this release
`At1g73270`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000086 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0016752 sinapoyltransferase activity Molecular Function

GO:0047202 sinapoylglucose-choline O-sinapoyltransferase activity Molecular Function

KEGG gene cross-reference

ag:QGI57842

ath:AT1G33540

ath:AT3G12203

ath:AT5G09640

ath:AT5G36180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.316

Rank 1 · TkA01G634700 · TK1151

Lysosome / Vacuole0.253

Rank 2 · TkA01G634700 · TK1151

Endoplasmic reticulum0.207

Rank 3 · TkA01G634700 · TK1151

Cytoplasm0.083

Rank 4 · TkA01G634700 · TK1151

Golgi apparatus0.061

Rank 5 · TkA01G634700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1047-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G634700	`PF00450`	Peptidase_S10	47	109	7.6e-20	72.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWJ6`	Arabidopsis thaliana	sp\|Q8RWJ6\|SCP1_ARATH Serine carboxypeptidase-like 1	53.600%	Swiss-Prot	High
`Q9CAU4`	Arabidopsis thaliana	sp\|Q9CAU4\|SCP4_ARATH Serine carboxypeptidase-like 4	54.300%	Swiss-Prot	High
`O81009`	Arabidopsis thaliana	sp\|O81009\|SCP12_ARATH Serine carboxypeptidase-like 12	60.200%	Swiss-Prot	High
`Q9CAU3`	Arabidopsis thaliana	sp\|Q9CAU3\|SCPL2_ARATH Serine carboxypeptidase-like 2	53.600%	Swiss-Prot	High
`Q9CAU0`	Arabidopsis thaliana	sp\|Q9CAU0\|SCP6_ARATH Serine carboxypeptidase-like 6	56.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card