TkA01G634380 | RubberDandelionOmics

Gene overview

TkA01G634380

Reference: TK1151 Chr: Chr01 Coordinates: 160480990-160482935 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1904 bp · TkA01G634380|TK1151|cDNA

CACATACATACATACATGTTAATGTATCTCTCTTCCCCATTCTCTCTCTCCTCTTGCACATCAATTCTTCTTGAAGCTCGTCTCTCCTTGTTCATTCACTCATTTCTTACGTACAACATAGGCTTGATTTACTTCTGTTTCGTTTTTTGGTCTAATCTTCTTCGTTGATTGTTTCGTTTGAGGTGTGCATATGAAAATCGTGTTTCAACTTCATTCTTGGATATCGTGAGGAATTTCTCACGATCGAGATCGCCGGAGCT...

CDS

Download CDS FASTA

951 bp · TkA01G634380|TK1151|CDS

ATGGGGCTTCAATTTCGAAGTTTACGGATACTTGTTCTGCTTATTTGCTTCCTCTGGCGGCCAAGAGTTGGATCTCCATTATCTAATTCTGAAACAAAACCTGCAAAGGCACTTGATACGACTCTCCAGGAATACGCCTACCGTGCATTTTTTCATCCACGTACCGGTATCCCGTTCGACGGCCTTGTCCCTCCCTATCTGACCGGAATTGAGATATCAGCAATGAGGCTCAGAAGCGGTAGCCTATTTCACAGAGGCGT...

Protein

Download Protein FASTA

316 aa · TkA01G634380|TK1151|PROTEIN

MGLQFRSLRILVLLICFLWRPRVGSPLSNSETKPAKALDTTLQEYAYRAFFHPRTGIPFDGLVPPYLTGIEISAMRLRSGSLFHRGVQTFKEFRVPTGIREEPYVERLVLVYQNLGNWSTTYYPLPGYTYLAPILGLLAYNGSDLSSTNLPELELWASNDPITIKFGQIRSKPASSHPKCVWFDRHGQVNFTNLEPDNQCLTYEQGHFSIVIESPPAPAPPEIAAPPEESVVTDGKENMPKVCTIVGIAGGGTILMVLMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G634380`
TK1151 ID	TkA01G634380
OH-1004 ID	LXL04_000102
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.684 / OH-1004 99.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G634380`
Location	Chr01:160480990-160482935 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000102` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.590

Rank 1 · TkA01G634380 · TK1151

Cytoplasm0.160

Rank 2 · TkA01G634380 · TK1151

Endoplasmic reticulum0.125

Rank 3 · TkA01G634380 · TK1151

Lysosome / Vacuole0.117

Rank 4 · TkA01G634380 · TK1151

Extracellular0.101

Rank 5 · TkA01G634380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14991MLANA8-50 aa

PF06305LapA_dom10-18 aa

PF05545FixQ11-21 aa

PF06697DUF119134-213 aa

PF05545FixQ41-47 aa

PF14991MLANA197-217 aa

PF16101PRIMA1214-287 aa

PF06305LapA_dom238-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G634380	`PF14991`	MLANA	8	50	0.016	16.1
TkA01G634380	`PF06305`	LapA_dom	10	18	0.0096	16.5
TkA01G634380	`PF05545`	FixQ	11	21	0.047	14.4
TkA01G634380	`PF06697`	DUF1191	34	213	7.1e-68	228.6
TkA01G634380	`PF05545`	FixQ	41	47	0.047	14.4
TkA01G634380	`PF14991`	MLANA	197	217	0.016	16.1
TkA01G634380	`PF16101`	PRIMA1	214	287	0.014	15.9
TkA01G634380	`PF06305`	LapA_dom	238	283	0.0096	16.5
TkA01G634380	`PF15681`	LAX	245	275	0.28	10.7
TkA01G634380	`PF14991`	MLANA	248	281	0.016	16.1
TkA01G634380	`PF05545`	FixQ	252	283	0.047	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card