TkA01G634290 | RubberDandelionOmics

Gene overview

TkA01G634290

Reference: TK1151 Chr: Chr01 Coordinates: 160453801-160454250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA01G634290|TK1151|cDNA

ATGAATCTAGAAGATGATGATGAAAGCCCAGGTACCCCAAAAGAAGGTGTATTTGACCCATTTGCCCCTGGTCCCGACAAGCTCATGAATGCTCCTCTTTCCATGAAACAACTTGAAGAATCACGGAGTTACGTCGCCAGAAGGCTTAATTTTAATAATTCTAATTTCACAAAAAAAGATTGTGAAAAGCGTGAATCTGGTTTTGAGGATGAAGCTTTATTGGAGGCGGTTTATGATTCTCTTTTGGAAGCAATTATTTC...

CDS

Download CDS FASTA

450 bp · TkA01G634290|TK1151|CDS

ATGAATCTAGAAGATGATGATGAAAGCCCAGGTACCCCAAAAGAAGGTGTATTTGACCCATTTGCCCCTGGTCCCGACAAGCTCATGAATGCTCCTCTTTCCATGAAACAACTTGAAGAATCACGGAGTTACGTCGCCAGAAGGCTTAATTTTAATAATTCTAATTTCACAAAAAAAGATTGTGAAAAGCGTGAATCTGGTTTTGAGGATGAAGCTTTATTGGAGGCGGTTTATGATTCTCTTTTGGAAGCAATTATTTC...

Protein

Download Protein FASTA

149 aa · TkA01G634290|TK1151|PROTEIN

MNLEDDDESPGTPKEGVFDPFAPGPDKLMNAPLSMKQLEESRSYVARRLNFNNSNFTKKDCEKRESGFEDEALLEAVYDSLLEAIISKQAEDILAEMTAVGLSCDGLETPPFAPRVSGIADTCPGAPMKPIRKSRNIDLSLCRRLDFDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G634290`
TK1151 ID	TkA01G634290
OH-1004 ID	LXL04_000107
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 67.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G634290

Location Chr01:160453801-160454250 (-)

Description Similar to Unknown protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28330`	Probable cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000107 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0004860 protein kinase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT2G28330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.817

Rank 1 · TkA01G634290 · TK1151

Cytoplasm0.314

Rank 2 · TkA01G634290 · TK1151

Cell membrane0.034

Rank 3 · TkA01G634290 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA01G634290 · TK1151

Plastid0.020

Rank 5 · TkA01G634290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27568SMR_1-1556-56 aa

PF29576SMR11_SMR1667-138 aa

PF27568SMR_1-15120-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G634290	`PF27568`	SMR_1-15	56	56	0.028	15.3
TkA01G634290	`PF29576`	SMR11_SMR16	67	138	2.2e-09	38.4
TkA01G634290	`PF27568`	SMR_1-15	120	149	0.028	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN7`	Arabidopsis thaliana	sp\|Q9SKN7\|SMR11_ARATH Cyclin-dependent protein kinase inhibitor SMR11	40.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card