TkA01G633990 | RubberDandelionOmics

Gene overview

TkA01G633990

Reference: TK1151 Chr: Chr01 Coordinates: 160383572-160384818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1162 bp · TkA01G633990|TK1151|cDNA

ACGCCATTCCATCTTCTCAGAATTCTCATAAGATCCTTCTTCTTCCTCTCTCTATCTCTCTCTAATTAGCACTGTAGCAGTCACAGAATTAGGACGTAGTTATGACAAAGGTATACCCGAACGCCATTGTTTCCGAGATCCAGGAACCACCCCCCGTTGCGGCGAATACTCCTCTTGCTCTCACAGTTTGGAAGAAGTCTTTGCTCTTCAACTGCTATGGCTTTACGGTGTTTGATTCCAATGGCAATCTCGTCTTTCGA...

CDS

Download CDS FASTA

591 bp · TkA01G633990|TK1151|CDS

ATGACAAAGGTATACCCGAACGCCATTGTTTCCGAGATCCAGGAACCACCCCCCGTTGCGGCGAATACTCCTCTTGCTCTCACAGTTTGGAAGAAGTCTTTGCTCTTCAACTGCTATGGCTTTACGGTGTTTGATTCCAATGGCAATCTCGTCTTTCGAGTAGACAAGTACACCGCCGAAGGCAACGCTGAGATCGTTCTTATGGACGCATTTGGTACACCTCTTCTCACCATCCGGCGTAAGCGGCTAAGCCTATTGGA...

Protein

Download Protein FASTA

196 aa · TkA01G633990|TK1151|PROTEIN

MTKVYPNAIVSEIQEPPPVAANTPLALTVWKKSLLFNCYGFTVFDSNGNLVFRVDKYTAEGNAEIVLMDAFGTPLLTIRRKRLSLLDNWLVFDGETTANPRFTVTKRVSILGTNFLAQVSAPGSRTKKVMYEIEGSYTQRSCTVYDERRRCVAEIRPKEAVGGVVFGGDVFRLFVQPDIDSTVAMALVVVLDQMFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G633990`
TK1151 ID	TkA01G633990
OH-1004 ID	LXL04_035926
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.600
Protein coverage (%)	TK1151 99.490 / OH-1004 93.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G633990

Location Chr01:160383572-160384818 (+)

Description Similar to At2g38640: Protein LURP-one-related 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38640`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At5g41590`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g80120`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At3g15810`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g33840`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035926 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G80120

ath:AT2G38640

ath:AT3G14260

ath:AT3G15810

ath:AT5G41590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA01G633990 · TK1151

Nucleus0.373

Rank 2 · TkA01G633990 · TK1151

Cell membrane0.245

Rank 3 · TkA01G633990 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA01G633990 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkA01G633990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525LOR26-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G633990	`PF04525`	LOR	26	192	5e-38	131.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVI6`	Arabidopsis thaliana	sp\|Q9ZVI6\|LOR8_ARATH Protein LURP-one-related 8	54.800%	Swiss-Prot	High
`A0MFL4`	Arabidopsis thaliana	sp\|A0MFL4\|LOR17_ARATH Protein LURP-one-related 17	44.000%	Swiss-Prot	Medium
`Q9SSC7`	Arabidopsis thaliana	sp\|Q9SSC7\|LOR5_ARATH Protein LURP-one-related 5	48.000%	Swiss-Prot	Medium
`Q9LVZ8`	Arabidopsis thaliana	sp\|Q9LVZ8\|LOR12_ARATH Protein LURP-one-related 12	43.600%	Swiss-Prot	Medium
`Q9LQ36`	Arabidopsis thaliana	sp\|Q9LQ36\|LOR1_ARATH Protein LURP-one-related 1	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card