TkA01G632680 | RubberDandelionOmics

Gene overview

TkA01G632680

Reference: TK1151 Chr: Chr01 Coordinates: 160049651-160052045 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1384 bp · TkA01G632680|TK1151|cDNA

TGATGGCTGAACCGCTGAAGAATGATGATAATGATAATTTCTCACAATCCCTTCTTTCTGTGACTGCTAAATACAAAATACTCCCCCCGGAACTGAAACTCTCAGTGAAATCAGCAACGGAGAAGAATGTCGAACGCCGTCGTGAATGGCCTTGCCGGAGCTGGCGGAGGTATAATTGCTCAAATCATCACCTATCCTCTCCAATCGGTCAACACGCGCCAACAGACAGAGAGAGTCGCAAAGAAATCTCAGTCTCAAGG...

CDS

Download CDS FASTA

1059 bp · TkA01G632680|TK1151|CDS

ATGTCGAACGCCGTCGTGAATGGCCTTGCCGGAGCTGGCGGAGGTATAATTGCTCAAATCATCACCTATCCTCTCCAATCGGTCAACACGCGCCAACAGACAGAGAGAGTCGCAAAGAAATCTCAGTCTCAAGGATCATCCGGCGGTACACTTGTTCAAATGCTTAAGGTTATAAGAAGTGAAGGGATTGGAGGACTATACAGTGGCCTTAAGCCTTCTCTTCTTGGAACTGCCACATCACAGGGGATTTATTATTATTT...

Protein

Download Protein FASTA

352 aa · TkA01G632680|TK1151|PROTEIN

MSNAVVNGLAGAGGGIIAQIITYPLQSVNTRQQTERVAKKSQSQGSSGGTLVQMLKVIRSEGIGGLYSGLKPSLLGTATSQGIYYYFYQVFKNKAESIAAANKRKGRGDGTVGMFSWLVVAALAGALNVLFTNPIWVLVTRMQTHTQAEQKILEAKKEALIREGGFIGSSLHAKLRELDSVKPNPYGTLHAAYEVYNEAGIRGFWKGIVPTLIMVCNPSIQFMIYESSIKHLKKKRADKKQTSTNVSALEVFLVGAIAKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G632680`
TK1151 ID	TkA01G632680
OH-1004 ID	LXL04_000122
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G632680

Location Chr01:160049651-160052045 (+)

Description Similar to PXN: Peroxisomal nicotinamide adenine dinucleotide carrier

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39970`	May mediate NAD⁺ import into peroxisomes.	A peroxisomal carrier delivers NAD⁺ and contributes to optimal fatty acid degradation during storage oil mobilization.2012 · DOI: 10.1111/j.1365-313x.2011.04775.x A defect of peroxisomal membrane protein 38 causes enlargement of peroxisomes.2011 · DOI: 10.1093/pcp/pcr147 The peroxisomal NAD+ carrier of Arabidopsis thaliana transports coenzyme A and its derivatives.2012 · DOI: 10.1007/s10863-012-9445-0
`At1g25380`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001561 fatty acid alpha-oxidation Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0015867 ATP transport Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0043132 NAD transport Biological Process

GO:0044375 regulation of peroxisome size Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1901679 nucleotide transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

KEGG gene cross-reference

ath:AT2G39970

ath:AT5G66380

ddi:DDB_G0272346

hsa:10478

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.597

Rank 1 · TkA01G632680 · TK1151

Mitochondrion0.258

Rank 2 · TkA01G632680 · TK1151

Endoplasmic reticulum0.053

Rank 3 · TkA01G632680 · TK1151

Cytoplasm0.045

Rank 4 · TkA01G632680 · TK1151

Cell membrane0.042

Rank 5 · TkA01G632680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr4-93 aa

PF03201HMD49-77 aa

PF30921GIGANTEA_M93-154 aa

PF00153Mito_carr115-164 aa

PF00153Mito_carr186-235 aa

PF03201HMD190-223 aa

PF30921GIGANTEA_M230-284 aa

PF00153Mito_carr246-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G632680	`PF00153`	Mito_carr	4	93	4.2e-56	187.4
TkA01G632680	`PF03201`	HMD	49	77	0.019	15.9
TkA01G632680	`PF30921`	GIGANTEA_M	93	154	0.021	14.9
TkA01G632680	`PF00153`	Mito_carr	115	164	4.2e-56	187.4
TkA01G632680	`PF00153`	Mito_carr	186	235	4.2e-56	187.4
TkA01G632680	`PF03201`	HMD	190	223	0.019	15.9
TkA01G632680	`PF30921`	GIGANTEA_M	230	284	0.021	14.9
TkA01G632680	`PF00153`	Mito_carr	246	338	4.2e-56	187.4
TkA01G632680	`PF03201`	HMD	253	338	0.019	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04200`	Arabidopsis thaliana	sp\|O04200\|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier	61.900%	Swiss-Prot	High
`Q8RWA5`	Arabidopsis thaliana	sp\|Q8RWA5\|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial	29.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card