TkA01G632550 | RubberDandelionOmics

Gene overview

TkA01G632550

Reference: TK1151 Chr: Chr01 Coordinates: 160013342-160014770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA01G632550|TK1151|cDNA

ATGGAATTAGCTACGGAATCAAATTCCATAGCTATTATACGTCTGTTCTATGGGCTGTGGGAGATCTCCGTCGGCCGCCGACAATCTCGATCTAGGGTGAAGTCCGGAATCTACCCTGAATGCACCTGCTACATCTACCATCAGATGACCATGGATTTAAACGAAGTTCCTTTCGGTGTCACAGAAAGTAAACACCGGCCGCCCGTTCAACCCCAGATTCACAACTTCAGTCCTTTATATGTAATGATGTCTGTATGGAA...

CDS

Download CDS FASTA

495 bp · TkA01G632550|TK1151|CDS

ATGGAATTAGCTACGGAATCAAATTCCATAGCTATTATACGTCTGTTCTATGGGCTGTGGGAGATCTCCGTCGGCCGCCGACAATCTCGATCTAGGGTGAAGTCCGGAATCTACCCTGAATGCACCTGCTACATCTACCATCAGATGACCATGGATTTAAACGAAGTTCCTTTCGGTGTCACAGAAAGTAAACACCGGCCGCCCGTTCAACCCCAGATTCACAACTTCAGTCCTTTATATGTAATGATGTCTGTATGGAA...

Protein

Download Protein FASTA

164 aa · TkA01G632550|TK1151|PROTEIN

MELATESNSIAIIRLFYGLWEISVGRRQSRSRVKSGIYPECTCYIYHQMTMDLNEVPFGVTESKHRPPVQPQIHNFSPLYVMMSVWNNGIFDAPQFEEVEQFCITSPNGNDSWDMHKKMIKNSEEFYQMLKLPYQIVPIVSGALNDAATKKYDLEVGCGKEVGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G632550`
TK1151 ID	TkA01G632550
OH-1004 ID	LXL04_000124
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G632550

Location Chr01:160013342-160014770 (+)

Description Similar to Serine--tRNA ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27470`	Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction: serine is first activated by ATP to form Ser-AMP and then transferred to the acceptor end of tRNA(Ser).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000124 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001514 selenocysteine incorporation Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0006434 seryl-tRNA aminoacylation Biological Process

GO:0106217 tRNA C3-cytosine methylation Biological Process

GO:1904046 negative regulation of vascular endothelial growth factor production Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

KEGG gene cross-reference

ath:AT5G27470

bta:281476

cel:CELE_C47E12.1

ddi:DDB_G0272660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.232

Rank 1 · TkA01G632550 · TK1151

Mitochondrion0.210

Rank 2 · TkA01G632550 · TK1151

Extracellular0.182

Rank 3 · TkA01G632550 · TK1151

Plastid0.164

Rank 4 · TkA01G632550 · TK1151

Nucleus0.105

Rank 5 · TkA01G632550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14288FKS1_dom138-64 aa

PF00587tRNA-synt_2b88-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G632550	`PF14288`	FKS1_dom1	38	64	0.0021	19.0
TkA01G632550	`PF00587`	tRNA-synt_2b	88	156	4.9e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39230`	Arabidopsis thaliana	sp\|Q39230\|SYSC_ARATH Serine--tRNA ligase, cytoplasmic	74.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card