TkA01G630790 | RubberDandelionOmics

Gene overview

TkA01G630790

Reference: TK1151 Chr: Chr01 Coordinates: 159508937-159510752 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA01G630790|TK1151|cDNA

TTCATCTTCTCCACCTTCACCTTTTTGCCCCTTTGAGCCCATTAGCGAACCGGAATACTTTCTTAGCTCCATAGTATGTCACTTCCCTATTTCTCCTCGCTTTCTTCGTTCACTTTTCTACCACCGCCGAGATCCTCGCCAACGCCAACCACTCGACTCCTTTGTAGTTTCCATACTCGACCATCCACCTCCACCACCGCAACAACCTTAAGTAACATCCTAAATTCCGGCGTCATTGCTTGTCTTCGCGCCAAAAGGTA...

CDS

Download CDS FASTA

564 bp · TkA01G630790|TK1151|CDS

ATGTGGCATTGGAGGCTGCAAGGGCTGCAATCACCGGTGGAATATCGGTTCTGGAGATTGTGGTTTCTACACCAGGTTTTACATCAACTGGTACAGGATTTTCCAACCACAACTTTAGGAGTTGGCACTGTTCTAAATACAGAGGATGCTACAAAAGCCAAAAATGCTGGTGCAAAGTTCATCATGAGTCCTGCAATTGTAAAGGACATTCTGGATGAAGACAGTGATGAGTTGCTATACATACCTGGTGCGATGACCCC...

Protein

Download Protein FASTA

187 aa · TkA01G630790|TK1151|PROTEIN

MWHWRLQGLQSPVEYRFWRLWFLHQVLHQLVQDFPTTTLGVGTVLNTEDATKAKNAGAKFIMSPAIVKDILDEDSDELLYIPGAMTPTEILSSYDAGAKIVKVYPVSALGGVQYIATLKKPFPNIPLIASQGITSDLIGEYISNGASSVVVSDAIFEKEAMAQRNFTAVYRLAQLAASQANRFVKKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G630790`
TK1151 ID	TkA01G630790
OH-1004 ID	LXL04_000156
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 87.166 / OH-1004 64.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G630790`
Location	Chr01:159508937-159510752 (+)
Description	Similar to kdgA: KHG/KDPG aldolase (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000156` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009255 Entner-Doudoroff pathway through 6-phosphogluconate Biological Process GO:0034194 D-galactonate catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0008674 2-dehydro-3-deoxy-6-phosphogalactonate aldolase activity Molecular Function GO:0008675 2-dehydro-3-deoxy-phosphogluconate aldolase activity Molecular Function GO:0008700 (R,S)-4-hydroxy-2-oxoglutarate aldolase activity Molecular Function GO:0008948 oxaloacetate decarboxylase activity Molecular Function GO:0016832 aldehyde-lyase activity Molecular Function GO:0016833 oxo-acid-lyase activity Molecular Function GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	bsu:BSU22100 ecj:JW1839 eco:b1850 ecoc:C3026_10540 pae:PA3181 pat:Patl_0974 sfl:SF1860 sfx:S1926 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.546

Rank 1 · TkA01G630790 · TK1151

Nucleus0.298

Rank 2 · TkA01G630790 · TK1151

Mitochondrion0.097

Rank 3 · TkA01G630790 · TK1151

Peroxisome0.085

Rank 4 · TkA01G630790 · TK1151

Extracellular0.068

Rank 5 · TkA01G630790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01081Aldolase27-171 aa

PF02581TMP-TENI44-112 aa

PF02581TMP-TENI110-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G630790	`PF01081`	Aldolase	27	171	6.7e-26	91.7
TkA01G630790	`PF02581`	TMP-TENI	44	112	0.067	13.3
TkA01G630790	`PF02581`	TMP-TENI	110	155	0.067	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card