TkA01G630550 | RubberDandelionOmics

Gene overview

TkA01G630550

Reference: TK1151 Chr: Chr01 Coordinates: 159446993-159450787 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2442 bp · TkA01G630550|TK1151|cDNA

ATGAACCGGAAATGCAAACTGTTCAGAAATGAAGCAGTTGGGCTAATCCAGTCCATGAAGGGCGGGGCTGTGATTTTCTTTGGTGATTTTAACGAAGTGAGACATGTGAACGAGAGGCGTGGCTCGACGTTTGATCAGAATGGGGCTAATGAACTAGACAATTTTATTAAAAACAACAACTTAGACGATCTAAGAATAGGGGGCAAAGAGTTTACTTGGCGAAACAAGAGTGGAACAAAATTAAGCAGACTAGACCGCAT...

CDS

Download CDS FASTA

2442 bp · TkA01G630550|TK1151|CDS

ATGAACCGGAAATGCAAACTGTTCAGAAATGAAGCAGTTGGGCTAATCCAGTCCATGAAGGGCGGGGCTGTGATTTTCTTTGGTGATTTTAACGAAGTGAGACATGTGAACGAGAGGCGTGGCTCGACGTTTGATCAGAATGGGGCTAATGAACTAGACAATTTTATTAAAAACAACAACTTAGACGATCTAAGAATAGGGGGCAAAGAGTTTACTTGGCGAAACAAGAGTGGAACAAAATTAAGCAGACTAGACCGCAT...

Protein

Download Protein FASTA

813 aa · TkA01G630550|TK1151|PROTEIN

MNRKCKLFRNEAVGLIQSMKGGAVIFFGDFNEVRHVNERRGSTFDQNGANELDNFIKNNNLDDLRIGGKEFTWRNKSGTKLSRLDRILISDDDIWRNAEGFEYHGNHLKMHVLMKRLQHLKSDIRKWAAMKKLEKDKLKKEELNTIRKIDSKMDEGIANNEDIQKSDKSLENLKKIQHKEIMEINQVFKNKWCLEGDENSKLFHKCLNKKKRKKRVKGIMREGIWESDPTIAKECFHKHFKYRFKKGASNDWENFAQRMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G630550`
TK1151 ID	TkA01G630550
OH-1004 ID	LXL04_009233
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.700
Protein coverage (%)	TK1151 65.560 / OH-1004 48.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G630550

Location Chr01:159446993-159450787 (-)

Description Similar to HDR1: Protein HEADING DATE REPRESSOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009233 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0793900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · TkA01G630550 · TK1151

Nucleus0.325

Rank 2 · TkA01G630550 · TK1151

Cell membrane0.077

Rank 3 · TkA01G630550 · TK1151

Plastid0.057

Rank 4 · TkA01G630550 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA01G630550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos12-93 aa

PF14529Exo_endo_phos_219-107 aa

PF00078RVT_1272-495 aa

PF03372Exo_endo_phos647-698 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G630550	`PF03372`	Exo_endo_phos	12	93	0.004	17.6
TkA01G630550	`PF14529`	Exo_endo_phos_2	19	107	0.015	15.9
TkA01G630550	`PF00078`	RVT_1	272	495	9.5e-29	101.4
TkA01G630550	`PF03372`	Exo_endo_phos	647	698	0.004	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	34.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card