RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G629880
Reference: TK1151 Chr: Chr01 Coordinates: 159269420-159270271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

810 bp · TkA01G629880|TK1151|cDNA

ATGGATCAATCAAGATATTGGATCCCGAAGGAAAGAGCTTGTTTAAATTCGCATGTGTTATCTTCGTTTGGTGATTCTTGGGAAGAACAAGCGTTCGCGGAAGATGCAGCCGGGCCACTCGGAGGTTGCATATGGCCGCCAAGATCTTACACTTGCAGTTTCTGTCGAAGAGAATTTCGGTCGGCGCAAGCTCTTGGGGGTCACATGAACGTTCATCGGAGAGATAGGGCAAGACTCAAGCAAAGTCCAGATAACAATCA...

CDS

Download CDS FASTA

810 bp · TkA01G629880|TK1151|CDS

ATGGATCAATCAAGATATTGGATCCCGAAGGAAAGAGCTTGTTTAAATTCGCATGTGTTATCTTCGTTTGGTGATTCTTGGGAAGAACAAGCGTTCGCGGAAGATGCAGCCGGGCCACTCGGAGGTTGCATATGGCCGCCAAGATCTTACACTTGCAGTTTCTGTCGAAGAGAATTTCGGTCGGCGCAAGCTCTTGGGGGTCACATGAACGTTCATCGGAGAGATAGGGCAAGACTCAAGCAAAGTCCAGATAACAATCA...

Protein

Download Protein FASTA

269 aa · TkA01G629880|TK1151|PROTEIN

MDQSRYWIPKERACLNSHVLSSFGDSWEEQAFAEDAAGPLGGCIWPPRSYTCSFCRREFRSAQALGGHMNVHRRDRARLKQSPDNNQILEPNNTSLVGRCNMLRNPNEIYNPNFDLDHAVFSSSSPRPSTSSNILRPFTCSFVQEQEKSTPILSWSKFEPGKRFQIADMGNQEKGFTKAIELNINTTSTSKKRNTRQIEDHFAGNMNSRVIGTCDITVGNEKKERDDDGLIFKRSNLINGDEGESVVSLKSSPNSTLELD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G629880
TK1151 IDTkA01G629880
OH-1004 IDLXL04_000169
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G629880
LocationChr01:159269420-159270271 (+)
DescriptionSimilar to ZFP10: Zinc finger protein 10
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g37740 Probable transcription factor that may regulate cell division and growth.
Ectopic expression of an Arabidopsis single zinc finger gene in tobacco results in dwarf plants.2002 · DOI: 10.1093/pcp/pcf086
At5g06070 Probable transcriptional regulator essential for petal development. No verified direct reference in this release
At2g42410 Probable transcription factor that may regulate cell division and growth. No verified direct reference in this release
At3g23130 Probable transcriptional regulator considered as cadastral protein that acts indirectly to prevent the B class homeotic proteins APETALA3 and perhaps PISTILLATA from acting in the gynoecial whorl.
Regulation of SUP expression identifies multiple regulators involved in arabidopsis floral meristem development.2000 · DOI: 10.1105/tpc.12.9.1607
The FLO10 Gene Product Regulates the Expression Domain of Homeotic Genes AP3 and PI in Arabidopsis Flowers.1991 · DOI: 10.1105/tpc.3.11.1221
At3g09290 Activation factor which mediates telomerase activity and potentiates responses to auxin through the regulation of BT2. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008361 regulation of cell size Biological Process
GO:0009409 response to cold Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009908 flower development Biological Process
GO:0010093 specification of floral organ identity Biological Process
GO:0030154 cell differentiation Biological Process
GO:0042127 regulation of cell population proliferation Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0048441 petal development Biological Process
GO:0090691 formation of plant organ boundary Biological Process
KEGG gene cross-reference
ath:AT2G37740
ath:AT2G42410
ath:AT3G09290
ath:AT3G23130
ath:AT5G06070
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970
Rank 1 · TkA01G629880 · TK1151
Cytoplasm0.091
Rank 2 · TkA01G629880 · TK1151
Cell membrane0.027
Rank 3 · TkA01G629880 · TK1151
Endoplasmic reticulum0.015
Rank 4 · TkA01G629880 · TK1151
Plastid0.012
Rank 5 · TkA01G629880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13894zf-C2H2_414-21 aa
PF26331DUF808626-32 aa
PF23077zf-C2H2_ZNF462_1st49-72 aa
PF13912zf-C2H2_650-74 aa
PF13894zf-C2H2_450-72 aa
PF00096zf-C2H250-72 aa
PF12171zf-C2H2_jaz50-70 aa
PF12756zf-C2H2_250-81 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G629880PF13894zf-C2H2_414210.0003321.8
TkA01G629880PF26331DUF808626322.08.4
TkA01G629880PF23077zf-C2H2_ZNF462_1st49720.05613.9
TkA01G629880PF13912zf-C2H2_650744.7e-0627.1
TkA01G629880PF13894zf-C2H2_450720.0003321.8
TkA01G629880PF00096zf-C2H250720.008817.2
TkA01G629880PF12171zf-C2H2_jaz50700.1612.9
TkA01G629880PF12756zf-C2H2_250810.2712.2
TkA01G629880PF12874zf-met50710.2912.2
TkA01G629880PF26331DUF80861202052.08.4
TkA01G629880PF10637Ofd1_CTDD1552540.2111.7
TkA01G629880PF12874zf-met2132210.2912.2
TkA01G629880PF12171zf-C2H2_jaz2142210.1612.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O80942Arabidopsis thalianasp|O80942|ZFP10_ARATH Zinc finger protein 1063.300%Swiss-ProtLow
Q9LHS9Arabidopsis thalianasp|Q9LHS9|RBE_ARATH Probable transcriptional regulator RABBIT EARS69.100%Swiss-ProtLow
Q9SLB8Arabidopsis thalianasp|Q9SLB8|ZFP11_ARATH Zinc finger protein 1164.900%Swiss-ProtLow
Q38895Arabidopsis thalianasp|Q38895|SUP_ARATH Transcriptional regulator SUPERMAN89.500%Swiss-ProtLow
Q9SR34Arabidopsis thalianasp|Q9SR34|TA1_ARATH Transcriptional regulator TAC158.000%Swiss-ProtLow

JBrowse

View in Genome Browser