TkA01G629280 | RubberDandelionOmics

Gene overview

TkA01G629280

Reference: TK1151 Chr: Chr01 Coordinates: 159154035-159154622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA01G629280|TK1151|cDNA

ATGGGTATGGTTTTCGGGAAAATCAGGGTGGAGACACCGAAATTCGAAGTCTTACAGTCGACAGCCGACTACGAGATCCGTAAATACCCACCATCGGTGGTGGCGGAGATCACCTACGACCCAACTCAATTTAAAGGGGACAAAGACGCCGGGTTTTCCATACTAGCCAAGTACATCGGCGCATTTGGCAACCCACAGAACACGAAGCCGGAAAAGATCGCGATGACGTCTCCGGTAATAACGAAGGCGGAGAATATAGC...

CDS

Download CDS FASTA

519 bp · TkA01G629280|TK1151|CDS

ATGGGTATGGTTTTCGGGAAAATCAGGGTGGAGACACCGAAATTCGAAGTCTTACAGTCGACAGCCGACTACGAGATCCGTAAATACCCACCATCGGTGGTGGCGGAGATCACCTACGACCCAACTCAATTTAAAGGGGACAAAGACGCCGGGTTTTCCATACTAGCCAAGTACATCGGCGCATTTGGCAACCCACAGAACACGAAGCCGGAAAAGATCGCGATGACGTCTCCGGTAATAACGAAGGCGGAGAATATAGC...

Protein

Download Protein FASTA

172 aa · TkA01G629280|TK1151|PROTEIN

MGMVFGKIRVETPKFEVLQSTADYEIRKYPPSVVAEITYDPTQFKGDKDAGFSILAKYIGAFGNPQNTKPEKIAMTSPVITKAENIAMTSPVVTKGSEGRVTMQFTLPEKYKKAKEAPTPVDERVVTEKLEKLKKDLERDGFKISGEYVLGRYNPPWCLPYFRTNEVMVPVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G629280`
TK1151 ID	TkA01G629280
OH-1004 ID	LXL04_000172
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G629280`
Location	Chr01:159154035-159154622 (-)
Description	Similar to At3g10130: Heme-binding-like protein At3g10130, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000172` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0010287 plastoglobule Cellular Component GO:0020037 heme binding Molecular Function
KEGG gene cross-reference	ath:AT3G10130 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.332

Rank 1 · TkA01G629280 · TK1151

Cytoplasm0.322

Rank 2 · TkA01G629280 · TK1151

Cell membrane0.232

Rank 3 · TkA01G629280 · TK1151

Nucleus0.131

Rank 4 · TkA01G629280 · TK1151

Endoplasmic reticulum0.122

Rank 5 · TkA01G629280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04832SOUL10-129 aa

PF00963Cohesin35-94 aa

PF00542Ribosomal_L12105-144 aa

PF23461ZMYND11_CC109-113 aa

PF04832SOUL123-170 aa

PF23461ZMYND11_CC123-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G629280	`PF04832`	SOUL	10	129	2.7e-35	122.7
TkA01G629280	`PF00963`	Cohesin	35	94	0.088	13.7
TkA01G629280	`PF00542`	Ribosomal_L12	105	144	0.069	14.2
TkA01G629280	`PF23461`	ZMYND11_CC	109	113	0.47	11.6
TkA01G629280	`PF04832`	SOUL	123	170	2.7e-35	122.7
TkA01G629280	`PF23461`	ZMYND11_CC	123	140	0.47	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card