Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3584 bp · TkA01G629270|TK1151|cDNA
TTTTGTATAATCCTGTCTATGCATATATGTGGTAACCAAAATAAAAACCACGATCATCACCATCTGATCATCCCCTCCCCCTATTTTTCTCTTTTCCACTTCTCTTCCTCCTCTCTCGTAACCCCTCGTTCCTCAAGAACAAAATATCATTTTTTTTTCCGGGAAACAAAAGAAAAACTTTGGAAATCCAAACCAGTACGATACGAAACCCTCTTGCGTTGTTGTTATTTAACAAAATGAGTAAAATGCAGCGGAGAACG...
2754 bp · TkA01G629270|TK1151|CDS
ATGAGTAAAATGCAGCGGAGAACGGTGACGATTAAGTGGGATAAGTTAGACGACTTCGATTTCGACGAAGACGATGAGTTCTTTGAAAGTACGAATCGTCTCTCGGCGGTGGTCCCTCTTGACATGCCAATATCTGGATTCGATCTTGATGACAACGACCAATTACAATTTGACGACGGCGTCGTTCCTTTCTCCAATAACTTTGCGGCAATCAACTCAATCAAGAAAAATCAAAGCTTTTTGGCCCCCGATTCTCAATA...
Protein
Download Protein FASTA917 aa · TkA01G629270|TK1151|PROTEIN
MSKMQRRTVTIKWDKLDDFDFDEDDEFFESTNRLSAVVPLDMPISGFDLDDNDQLQFDDGVVPFSNNFAAINSIKKNQSFLAPDSQYDMWMVAPGSIRDRRRRLFEDMGLNSNKDFTRLTTNKLNKAYTKRLVSIKPVVNSLDTNIADEKTNVVSAVKESPPPSKESKNVEQKQEDSRPSAENRPQPQPQPQFQSPPKLHSQQQSEPQPEPQPPPPRPAQAPVQAKAQASTLPVLLIRSRSDGDIDTNSFNAKQRKVELI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G629270 |
|---|---|
| TK1151 ID | TkA01G629270 |
| OH-1004 ID | LXL04_000173 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 93.500 |
| Protein coverage (%) | TK1151 99.019 / OH-1004 86.428Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G629270 |
|---|---|
| Location | Chr01:159148910-159153061 (-) |
| Description | Similar to WDR44: WD repeat-containing protein 44 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0030334 regulation of cell migration Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0045724 positive regulation of cilium assembly Biological Process GO:0060627 regulation of vesicle-mediated transport Biological Process GO:0061512 protein localization to cilium Biological Process GO:0061824 cytosolic ciliogenesis Biological Process GO:1902018 negative regulation of cilium assembly Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005874 microtubule Cellular Component GO:0010008 endosome membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component |
| KEGG gene cross-reference | bta:286825 hsa:54521 mmu:72404 xla:734726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30361TRM82_WD157-186 aaPF10241KxDL249-274 aaPF24782WD40_MABP1-WDR62_2nd296-376 aaPF21300LbR_Ice_bind434-486 aaPF10241KxDL440-470 aaPF21300LbR_Ice_bind449-520 aaPF10241KxDL471-483 aaPF24797Beta-prop_WDR35_TULP_N579-630 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G629270 | PF30361 | TRM82_WD | 157 | 186 | 0.26 | 10.8 |
| TkA01G629270 | PF10241 | KxDL | 249 | 274 | 1.8 | 9.7 |
| TkA01G629270 | PF24782 | WD40_MABP1-WDR62_2nd | 296 | 376 | 3.5e-09 | 36.8 |
| TkA01G629270 | PF21300 | LbR_Ice_bind | 434 | 486 | 1.6 | 9.6 |
| TkA01G629270 | PF10241 | KxDL | 440 | 470 | 1.8 | 9.7 |
| TkA01G629270 | PF21300 | LbR_Ice_bind | 449 | 520 | 1.6 | 9.6 |
| TkA01G629270 | PF10241 | KxDL | 471 | 483 | 1.8 | 9.7 |
| TkA01G629270 | PF24797 | Beta-prop_WDR35_TULP_N | 579 | 630 | 0.00017 | 21.5 |
| TkA01G629270 | PF25047 | Beta-prop_TEP1_2nd | 585 | 638 | 3e-17 | 63.3 |
| TkA01G629270 | PF25174 | Beta-prop_THOC3 | 586 | 634 | 1.7e-36 | 126.4 |
| TkA01G629270 | PF25172 | Beta-prop_WDR3_2nd | 586 | 631 | 4.4e-21 | 76.1 |
| TkA01G629270 | PF24105 | Beta-prop_CAF1B_HIR1 | 586 | 638 | 2e-18 | 67.3 |
| TkA01G629270 | PF23215 | WD_LRWD1 | 587 | 627 | 0.15 | 11.7 |
| TkA01G629270 | PF24807 | WD40_CDC20-Fz | 588 | 633 | 3.8e-24 | 86.2 |
| TkA01G629270 | PF23756 | Beta-prop_HPS5 | 588 | 628 | 9.2e-05 | 22.5 |
| TkA01G629270 | PF23609 | Beta-prop_EIPR1 | 588 | 625 | 0.00019 | 21.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.