TkA01G627170 | RubberDandelionOmics

Gene overview

TkA01G627170

Reference: TK1151 Chr: Chr01 Coordinates: 158347530-158348222 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA01G627170|TK1151|cDNA

ATGACAGCTTCTCCTTCCTGCATCTTCTGTCAGTTTGCTCACAATTCCACCACAACAACTACTCTCCTCCACACCGATGAGAAGGTAGTTGCGTTTCAAGACATTAATCCTTCAGCCTTTAGACATTACTTGGTGATCCCTGTGGAACACATTGCAACTATTAAGGACCTAAGAAGGAGAAACGAAGACTATTCTTTGGTCAGTCATATGTTAAATGTGGGGCAGACACTTCTCCATCGAGATGCACCTAACTCGACTCA...

CDS

Download CDS FASTA

354 bp · TkA01G627170|TK1151|CDS

ATGACAGCTTCTCCTTCCTGCATCTTCTGTCAGTTTGCTCACAATTCCACCACAACAACTACTCTCCTCCACACCGATGAGAAGGTAGTTGCGTTTCAAGACATTAATCCTTCAGCCTTTAGACATTACTTGGTGATCCCTGTGGAACACATTGCAACTATTAAGGACCTAAGAAGGAGAAACGAAGACTATTCTTTGGTCAGTCATATGTTAAATGTGGGGCAGACACTTCTCCATCGAGATGCACCTAACTCGACTCA...

Protein

Download Protein FASTA

117 aa · TkA01G627170|TK1151|PROTEIN

MTASPSCIFCQFAHNSTTTTTLLHTDEKVVAFQDINPSAFRHYLVIPVEHIATIKDLRRRNEDYSLVSHMLNVGQTLLHRDAPNSTHYRFGFHQPPFNSVNHLHLHCLALPYVSRCV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G627170`
TK1151 ID	TkA01G627170
OH-1004 ID	LXL04_016984
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 98.291 / OH-1004 80.986 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G627170

Location Chr01:158347530-158348222 (+)

Description Similar to HINT4: Bifunctional adenosine 5'-phosphosulfate phosphorylase/adenylylsulfatase HINT4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16566`	Possesses adenylylsulfatase activity in vitro, releasing AMP and sulfate from adenylyl sulfate.	Dual activity of certain HIT-proteins: A. thaliana Hint4 and C. elegans DcpS act on adenosine 5'-phosphosulfate as hydrolases (forming AMP) and as phosphorylases (forming ADP).2010 · DOI: 10.1016/j.febslet.2009.11.003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016984 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006790 sulfur compound metabolic process Biological Process

GO:0009150 purine ribonucleotide metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004780 sulfate adenylyltransferase (ADP) activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0043530 adenosine 5'-monophosphoramidase activity Molecular Function

GO:0047627 adenylylsulfatase activity Molecular Function

KEGG gene cross-reference

ath:AT4G16566

hsa:135114

pon:100172685

xtr:733971

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · TkA01G627170 · TK1151

Nucleus0.451

Rank 2 · TkA01G627170 · TK1151

Mitochondrion0.087

Rank 3 · TkA01G627170 · TK1151

Peroxisome0.070

Rank 4 · TkA01G627170 · TK1151

Cell membrane0.051

Rank 5 · TkA01G627170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11969DcpS_C6-115 aa

PF02611CDH6-56 aa

PF01230HIT19-109 aa

PF26217GDPGP1_N84-107 aa

PF02611CDH102-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G627170	`PF11969`	DcpS_C	6	115	7.5e-29	101.2
TkA01G627170	`PF02611`	CDH	6	56	0.029	14.7
TkA01G627170	`PF01230`	HIT	19	109	3.4e-10	41.2
TkA01G627170	`PF26217`	GDPGP1_N	84	107	1.1	9.5
TkA01G627170	`PF02611`	CDH	102	108	0.029	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84VV6`	Arabidopsis thaliana	sp\|Q84VV6\|HINT4_ARATH Bifunctional adenosine 5'-phosphosulfate phosphorylase/adenylylsulfatase HINT4	74.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card