TkA01G626990 | RubberDandelionOmics

Gene overview

TkA01G626990

Reference: TK1151 Chr: Chr01 Coordinates: 158262983-158272900 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3722 bp · TkA01G626990|TK1151|cDNA

CTCTTCTAGATTGTGGGATAAACAAAACAAGGCATTTATTTGTCAGAAACAAATAATTAATGTTTTGTATACATCCATAGAGTGCAAGCTATAAATACCACATTAATACAAAGCTCAAATACCCCAATCAACCTCCTTCCTTTCTTTCTCTCCCATTCTACAATAAAGTCAAGCTTCCTAATTCTTTTATCCTACAAGCCACCAATCAGGGCAAACTGGTAATTCCACAAAACCTACAACTAGCCTGCCTTCACATTCTG...

CDS

Download CDS FASTA

1815 bp · TkA01G626990|TK1151|CDS

ATGAAAGATGGTGATTTTCATGGGTTTTTCAATAGGATTTGTGTTACGTATTCAAGTGAAAAGAATGAAAGATTCTTTGGATTTGGAGAACAATTTTCACGTATGGATTTTAAAGGAACGAAAGTCCCGATTTTTGTTCAAGAACAAGGTATCGGGAGAGGTGACCAACCCATTACTTTTGCTGCTAATCTTGTTAGCTATAGGGCAGGGGGGGATTGGAGTACAACATACGCGCCTTCACCATTTTACATGACATCAAA...

Protein

Download Protein FASTA

604 aa · TkA01G626990|TK1151|PROTEIN

MKDGDFHGFFNRICVTYSSEKNERFFGFGEQFSRMDFKGTKVPIFVQEQGIGRGDQPITFAANLVSYRAGGDWSTTYAPSPFYMTSKMRSLYLEGYEYSVFDLTQDDSVQIQVHGDSVEGRILYGNSPCELIEQFTESIGRPPPLPDWIISGAIVGMQGGTNLVRTVWEDLVTHDVPISAFWLQDWVGERKTVIGSQLWWNWEVDETRYKGWKELIKDLSSRHIKVMTYCNPCLAPMDRKADARRNLFEEAKKLDILVKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G626990`
TK1151 ID	TkA01G626990
OH-1004 ID	LXL04_000229
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 71.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G626990

Location Chr01:158262983-158272900 (+)

Description Similar to yihQ: Sulfoquinovosidase (Escherichia coli (strain K12)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68560`	Glycoside hydrolase releasing xylosyl residues from xyloglucan oligosaccharides at the non-reducing end.	AXY3 encodes a α-xylosidase that impacts the structure and accessibility of the hemicellulose xyloglucan in Arabidopsis plant cell walls.2011 · DOI: 10.1007/s00425-010-1330-7

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0675700`	Probable alpha-glucosidase Os06g0675700.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000229 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0061720 6-sulfoquinovose(1-) catabolic process to glycerone phosphate and 3-sulfolactaldehyde Biological Process

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0004558 alpha-1,4-glucosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0033825 oligosaccharide 4-alpha-D-glucosyltransferase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0061634 alpha-D-xyloside xylohydrolase activity Molecular Function

GO:0080176 xyloglucan 1,6-alpha-xylosidase activity Molecular Function

GO:1990929 sulfoquinovosidase activity Molecular Function

KEGG gene cross-reference

atu:Atu3285

cja:CJA_3248

ecj:JW3631

ecj:JW3849

eco:b3656

eco:b3878

ecoc:C3026_19805

ecoc:C3026_20965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA01G626990 · TK1151

Endoplasmic reticulum0.323

Rank 2 · TkA01G626990 · TK1151

Nucleus0.170

Rank 3 · TkA01G626990 · TK1151

Golgi apparatus0.108

Rank 4 · TkA01G626990 · TK1151

Mitochondrion0.093

Rank 5 · TkA01G626990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13802Gal_mutarotas_217-87 aa

PF21365Glyco_hydro_31_3rd34-49 aa

PF01055Glyco_hydro_31_2nd161-469 aa

PF21365Glyco_hydro_31_3rd188-215 aa

PF21365Glyco_hydro_31_3rd499-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G626990	`PF13802`	Gal_mutarotas_2	17	87	0.00085	20.3
TkA01G626990	`PF21365`	Glyco_hydro_31_3rd	34	49	1.2e-15	58.5
TkA01G626990	`PF01055`	Glyco_hydro_31_2nd	161	469	9.5e-38	131.0
TkA01G626990	`PF21365`	Glyco_hydro_31_3rd	188	215	1.2e-15	58.5
TkA01G626990	`PF21365`	Glyco_hydro_31_3rd	499	590	1.2e-15	58.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Y7`	Arabidopsis thaliana	sp\|Q9S7Y7\|XYL1_ARATH Alpha-xylosidase 1	23.300%	Swiss-Prot	Low
`Q653V7`	Oryza sativa subsp. japonica	sp\|Q653V7\|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700	21.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card