TkA01G626980 | RubberDandelionOmics

Gene overview

TkA01G626980

Reference: TK1151 Chr: Chr01 Coordinates: 158256421-158256828 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA01G626980|TK1151|cDNA

ATGTTCCTGGAAGTGAAAGAAATCACTGAGAAAGTTGAGGTAATTTCTCACCTGTTGAGCCAGAAAGTTGAAGTCACTAAACTATCCACTCACTTGAATTTATCCCCCAGTATGTGTGCAGTCACTCTACTAGCACTCGGAAACGGCGCTCCTGATGTGTTTGCATCAGTCGCTGCTGTCAGTGGTGGCAACGCCCGAACTGGATTCGGCGCGATTTTATCAGCTGGAACTTTCGTTTCAGCTCCCTTCGCGGTGTCCCC...

CDS

Download CDS FASTA

408 bp · TkA01G626980|TK1151|CDS

ATGTTCCTGGAAGTGAAAGAAATCACTGAGAAAGTTGAGGTAATTTCTCACCTGTTGAGCCAGAAAGTTGAAGTCACTAAACTATCCACTCACTTGAATTTATCCCCCAGTATGTGTGCAGTCACTCTACTAGCACTCGGAAACGGCGCTCCTGATGTGTTTGCATCAGTCGCTGCTGTCAGTGGTGGCAACGCCCGAACTGGATTCGGCGCGATTTTATCAGCTGGAACTTTCGTTTCAGCTCCCTTCGCGGTGTCCCC...

Protein

Download Protein FASTA

135 aa · TkA01G626980|TK1151|PROTEIN

MFLEVKEITEKVEVISHLLSQKVEVTKLSTHLNLSPSMCAVTLLALGNGAPDVFASVAAVSGGNARTGFGAILSAGTFVSAPFAVSPCSLYKGRVVLFDCYVILSQKEESTNGFQRFNEYQSSFSKIITDGKEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G626980`
TK1151 ID	TkA01G626980
OH-1004 ID	LXL04_011974
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.800
Protein coverage (%)	TK1151 72.593 / OH-1004 67.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G626980

Location Chr01:158256421-158256828 (-)

Description Similar to CCX5: Cation/calcium exchanger 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08960`	May act as a membrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K⁺ uptake and Na⁺ transport in yeast.2011 · DOI: 10.1016/j.bbrc.2011.09.030
`At5g17860`	Vacuolar membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At3g14070`	May act as an endomembrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At1g54115`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011974 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0099093 calcium export from the mitochondrion Biological Process

GO:2001256 regulation of store-operated calcium entry Biological Process

KEGG gene cross-reference

ath:AT1G08960

cel:CELE_C07A9.11

mmu:170756

rno:498185

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.275

Rank 1 · TkA01G626980 · TK1151

Cytoplasm0.225

Rank 2 · TkA01G626980 · TK1151

Cell membrane0.188

Rank 3 · TkA01G626980 · TK1151

Lysosome / Vacuole0.148

Rank 4 · TkA01G626980 · TK1151

Nucleus0.143

Rank 5 · TkA01G626980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex25-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G626980	`PF01699`	Na_Ca_ex	25	83	6.3e-11	43.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04034`	Arabidopsis thaliana	sp\|O04034\|CCX5_ARATH Cation/calcium exchanger 5	77.300%	Swiss-Prot	Low
`Q9FKP1`	Arabidopsis thaliana	sp\|Q9FKP1\|CCX1_ARATH Cation/calcium exchanger 1	45.200%	Swiss-Prot	Medium
`Q9LJI2`	Arabidopsis thaliana	sp\|Q9LJI2\|CCX3_ARATH Cation/calcium exchanger 3	41.800%	Swiss-Prot	Medium
`Q9SYG9`	Arabidopsis thaliana	sp\|Q9SYG9\|CCX4_ARATH Cation/calcium exchanger 4	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card