Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA01G625730|TK1151|cDNA
CACGTCAGAGGGATTCAACTGTTCAACAATAAGTTCTCAGGTTCAATCCCTCCTACATTCGGTTCATGTACATCGCTTCAAAATCTCGATTTTGGTAATAATTCGTTGGTGGGTGAAATCCCTGATTCGTTTGGTAACTGCACTAAGCTTTATAATGTCAATTTGAGTTTGAATTCATTGACGGGTTCCGTTCCTGTATCCCTCTCGCAATCCAATTCCCTCATGTTTCTATCTCTCCAATTCAACAATTTTTCAGGGGT...
321 bp · TkA01G625730|TK1151|CDS
CACGTCAGAGGGATTCAACTGTTCAACAATAAGTTCTCAGGTTCAATCCCTCCTACATTCGGTTCATGTACATCGCTTCAAAATCTCGATTTTGGTAATAATTCGTTGGTGGGTGAAATCCCTGATTCGTTTGGTAACTGCACTAAGCTTTATAATGTCAATTTGAGTTTGAATTCATTGACGGGTTCCGTTCCTGTATCCCTCTCGCAATCCAATTCCCTCATGTTTCTATCTCTCCAATTCAACAATTTTTCAGGGGT...
Protein
Download Protein FASTA106 aa · TkA01G625730|TK1151|PROTEIN
HVRGIQLFNNKFSGSIPPTFGSCTSLQNLDFGNNSLVGEIPDSFGNCTKLYNVNLSLNSLTGSVPVSLSQSNSLMFLSLQFNNFSGVLPDSWGGGKNGDKSIVKSS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G625730 |
|---|---|
| TK1151 ID | TkA01G625730 |
| OH-1004 ID | LXL04_011595 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.100 |
| Protein coverage (%) | TK1151 99.057 / OH-1004 19.056Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G625730 |
|---|---|
| Location | Chr01:157953026-157953346 (-) |
| Description | Similar to ACX3: Acyl-coenzyme A oxidase 3, peroxisomal |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006635 fatty acid beta-oxidation Biological Process GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process GO:0051791 medium-chain fatty acid metabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005777 peroxisome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0003997 acyl-CoA oxidase activity Molecular Function GO:0004672 protein kinase activity Molecular Function GO:0005504 fatty acid binding Molecular Function GO:0005524 ATP binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G06290 ath:AT3G51740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00560LRR_14-23 aaPF12799LRR_44-40 aaPF13855LRR_85-50 aaPF24141LRR_ComC6-47 aaPF13306LRR_520-57 aaPF12799LRR_424-60 aaPF00560LRR_125-47 aaPF13855LRR_834-84 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G625730 | PF00560 | LRR_1 | 4 | 23 | 1.1e-13 | 49.1 |
| TkA01G625730 | PF12799 | LRR_4 | 4 | 40 | 2e-07 | 31.8 |
| TkA01G625730 | PF13855 | LRR_8 | 5 | 50 | 1.2e-06 | 28.8 |
| TkA01G625730 | PF24141 | LRR_ComC | 6 | 47 | 0.026 | 14.9 |
| TkA01G625730 | PF13306 | LRR_5 | 20 | 57 | 0.088 | 13.4 |
| TkA01G625730 | PF12799 | LRR_4 | 24 | 60 | 2e-07 | 31.8 |
| TkA01G625730 | PF00560 | LRR_1 | 25 | 47 | 1.1e-13 | 49.1 |
| TkA01G625730 | PF13855 | LRR_8 | 34 | 84 | 1.2e-06 | 28.8 |
| TkA01G625730 | PF00560 | LRR_1 | 50 | 69 | 1.1e-13 | 49.1 |
| TkA01G625730 | PF12799 | LRR_4 | 53 | 84 | 2e-07 | 31.8 |
| TkA01G625730 | PF00560 | LRR_1 | 73 | 93 | 1.1e-13 | 49.1 |
| TkA01G625730 | PF24141 | LRR_ComC | 75 | 92 | 0.026 | 14.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.