TkA01G623760 | RubberDandelionOmics

Gene overview

TkA01G623760

Reference: TK1151 Chr: Chr01 Coordinates: 157434929-157436767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · TkA01G623760|TK1151|cDNA

ATGGCTGTTACAGACAACGTCGTGGACAAATATTGGATGGGAGCGAGTAGAAACACACAAACATTTATCAAGGGTGTTGATGCTTTCTTGGAATATGCAGTTTCCAATTACAAGAATGTTCACAATAAAGACCATAAAGACCAAAATAGCTCTAGAAGATGGTTGTTCCTCTTCTTGTGGTGTGATGATCCAGTGCAACAATTTGTATTGACAGTCCTAGCCAGCGGTATTTGCAAAATTGGAAGGTTATTTCAAAAAAA...

CDS

Download CDS FASTA

1113 bp · TkA01G623760|TK1151|CDS

ATGGCTGTTACAGACAACGTCGTGGACAAATATTGGATGGGAGCGAGTAGAAACACACAAACATTTATCAAGGGTGTTGATGCTTTCTTGGAATATGCAGTTTCCAATTACAAGAATGTTCACAATAAAGACCATAAAGACCAAAATAGCTCTAGAAGATGGTTGTTCCTCTTCTTGTGGTGTGATGATCCAGTGCAACAATTTGTATTGACAGTCCTAGCCAGCGGTATTTGCAAAATTGGAAGGTTATTTCAAAAAAA...

Protein

Download Protein FASTA

370 aa · TkA01G623760|TK1151|PROTEIN

MAVTDNVVDKYWMGASRNTQTFIKGVDAFLEYAVSNYKNVHNKDHKDQNSSRRWLFLFLWCDDPVQQFVLTVLASGICKIGRLFQKKWHHIVFSGLNGISTDQLVSHGKSCIINEGGQFEIGKIATVQKGLLSSSVFVRLCPTLFFPLGVQEQEPYRDTSLLLRCSAAPLLCCSSASLCCSASLLAIGDMDFKVGQPIEIIADGSGFRASYYTGTVVQVYDDYNERVAVRYDKVKDYNGNPLVDDLPKEDLRPVAPKVDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G623760`
TK1151 ID	TkA01G623760
OH-1004 ID	LXL04_039589
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.100
Protein coverage (%)	TK1151 57.568 / OH-1004 24.358 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G623760`
Location	Chr01:157434929-157436767 (-)
Description	Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039589` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0042393 histone binding Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G09320 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.417

Rank 1 · TkA01G623760 · TK1151

Nucleus0.397

Rank 2 · TkA01G623760 · TK1151

Cell membrane0.120

Rank 3 · TkA01G623760 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA01G623760 · TK1151

Mitochondrion0.105

Rank 5 · TkA01G623760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13963Transpos_assoc10-38 aa

PF21743PTM_DIR17_Tudor81-95 aa

PF05641Agenet195-256 aa

PF18115Tudor_3206-232 aa

PF21743PTM_DIR17_Tudor207-232 aa

PF05641Agenet275-284 aa

PF05641Agenet287-337 aa

PF18115Tudor_3291-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G623760	`PF13963`	Transpos_assoc	10	38	0.021	15.7
TkA01G623760	`PF21743`	PTM_DIR17_Tudor	81	95	4.1	8.0
TkA01G623760	`PF05641`	Agenet	195	256	4.1e-14	53.5
TkA01G623760	`PF18115`	Tudor_3	206	232	0.0081	16.7
TkA01G623760	`PF21743`	PTM_DIR17_Tudor	207	232	4.1	8.0
TkA01G623760	`PF05641`	Agenet	275	284	4.1e-14	53.5
TkA01G623760	`PF05641`	Agenet	287	337	4.1e-14	53.5
TkA01G623760	`PF18115`	Tudor_3	291	315	0.0081	16.7
TkA01G623760	`PF21743`	PTM_DIR17_Tudor	294	315	4.1	8.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card