TkA01G621370 | RubberDandelionOmics

Gene overview

TkA01G621370

Reference: TK1151 Chr: Chr01 Coordinates: 156799411-156801473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1085 bp · TkA01G621370|TK1151|cDNA

AAGATCTTGCTTTGTGGGTTGTGTGGGTCTTTCTTTCACATAAAAACATCATCCTCCCTTATTTCCTCCATCAAGAAACCAAACCCAAAAAAAAACCCATCTTTTTTTGGCTAACTTCTTCCTCATTATAACCATTATCATCTTCTTCTTCTCTTCTTGAGATCTGCAAATCTTGTTCTCATGGGTGTCGCAGCAGATTCGCAGTTCCATGTTCTTGCTGTCGATGATAGCATCATCGATAGAAAACTGATTGAAAGACT...

CDS

Download CDS FASTA

639 bp · TkA01G621370|TK1151|CDS

ATGGGTGTCGCAGCAGATTCGCAGTTCCATGTTCTTGCTGTCGATGATAGCATCATCGATAGAAAACTGATTGAAAGACTCCTCAAAGTCTCATCATTTCAAGTTACGACTGTGGATTCCGGAAGTAAGGCTTTAGAATTTCTTGGATTGCATGAAGATGATGAAATTAATTCAAATCAACCTTCCGTATCTCCAAATATCAATCAGGAAGTGGGAGTCAATCTGATAATCACTGACTATTGTATGCCTGGAATGACAGG...

Protein

Download Protein FASTA

212 aa · TkA01G621370|TK1151|PROTEIN

MGVAADSQFHVLAVDDSIIDRKLIERLLKVSSFQVTTVDSGSKALEFLGLHEDDEINSNQPSVSPNINQEVGVNLIITDYCMPGMTGYDLLKKVKKSSSFKDIPVVIMSSENVPARISRCLEEGADEFFLKPVRLSDVNKLKPHMMRTKIKENDHHEYDQEHEKHQEQIVLETQEDESEQQSNGNKRKSMEDGSVTRQNKTQIQWWPYCRFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G621370`
TK1151 ID	TkA01G621370
OH-1004 ID	LXL04_034308
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.800
Protein coverage (%)	TK1151 74.057 / OH-1004 44.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G621370

Location Chr01:156799411-156801473 (-)

Description Similar to RR9: Two-component response regulator ORR9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57040`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`At2g41310`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BLZ4`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`Os12g0139400`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`UniProt: Q4GZK2`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034308 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000156 phosphorelay response regulator activity Molecular Function

KEGG gene cross-reference

ath:AT3G57040

dosa:Os11g0143300

dosa:Os12g0139400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.947

Rank 1 · TkA01G621370 · TK1151

Cytoplasm0.142

Rank 2 · TkA01G621370 · TK1151

Cell membrane0.030

Rank 3 · TkA01G621370 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA01G621370 · TK1151

Plastid0.012

Rank 5 · TkA01G621370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072Response_reg11-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G621370	`PF00072`	Response_reg	11	138	1e-18	68.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80366`	Arabidopsis thaliana	sp\|O80366\|ARR9_ARATH Two-component response regulator ARR9	78.900%	Swiss-Prot	High
`O80365`	Arabidopsis thaliana	sp\|O80365\|ARR8_ARATH Two-component response regulator ARR8	75.500%	Swiss-Prot	High
`B8BLZ4`	Oryza sativa subsp. indica	sp\|B8BLZ4\|ORR10_ORYSI Two-component response regulator ORR10	72.500%	Swiss-Prot	High
`Q2QXY3`	Oryza sativa subsp. japonica	sp\|Q2QXY3\|ORR10_ORYSJ Two-component response regulator ORR10	72.500%	Swiss-Prot	High
`Q4GZK2`	Oryza sativa subsp. indica	sp\|Q4GZK2\|ORR9_ORYSI Two-component response regulator ORR9	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card