TkA01G621310 | RubberDandelionOmics

Gene overview

TkA01G621310

Reference: TK1151 Chr: Chr01 Coordinates: 156785428-156787752 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

857 bp · TkA01G621310|TK1151|cDNA

ATTCATCTTTGTCATGAGACATCATATTCAAAGAAGAAAATTGATATTCAATAACAGAATTTTGGCGGAAAAGGCAAACTCGTTCAACGCGTAGACGGTAGCGGAGCGAAAAAGAAGCTGTTTCAGACGAAAGATCTCCGGATTTAGGTGCAAATGGGTGTATATGGAGAACCATCGAGGAGAGACAAGCCTAGAGGACGCCATCATGGGTTAACTCAGCAGAAAAGGCAAGAGATCAAAGAAGCATTTGAACTCTTTGA...

CDS

Download CDS FASTA

507 bp · TkA01G621310|TK1151|CDS

ATGGGTGTATATGGAGAACCATCGAGGAGAGACAAGCCTAGAGGACGCCATCATGGGTTAACTCAGCAGAAAAGGCAAGAGATCAAAGAAGCATTTGAACTCTTTGACACTGATGGCTCTGGCACCATTGATGCCAAGGAGTTGAATGTTGCAATGAGGGCCCTTGGTTTTGAAATGACAGAGGAGCAAATTAATCAAATGATAGCGGATGTAGACAAAGATGGAAGTGGTGCAATTGATTTTGATGAATTTGTGTATAT...

Protein

Download Protein FASTA

168 aa · TkA01G621310|TK1151|PROTEIN

MGVYGEPSRRDKPRGRHHGLTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFVYMMTAKIGERDSKQELTKAFQIIDQDNNGKISFSDIKNIAKELGEHFTDEEINEMVEEADRDHDGEVSVDEFMRMMKRTSYGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G621310`
TK1151 ID	TkA01G621310
OH-1004 ID	LXL04_000307
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G621310

Location Chr01:156785428-156787752 (-)

Description Similar to Caltractin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50360`	Potential calcium sensor.	No verified direct reference in this release
`At4g37010`	Potential calcium sensor that binds calcium in vitro.	CENTRIN2 interacts with the Arabidopsis homolog of the human XPC protein (AtRAD4) and contributes to efficient synthesis-dependent repair of bulky DNA lesions.2006 · DOI: 10.1007/s11103-006-0016-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0618800`	Potential calcium sensor.	No verified direct reference in this release
`Os10g0389000`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000307 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006281 DNA repair Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005814 centriole Cellular Component

GO:0005815 microtubule organizing center Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G50360

ath:AT4G37010

dosa:Os07g0618800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · TkA01G621310 · TK1151

Nucleus0.353

Rank 2 · TkA01G621310 · TK1151

Cell membrane0.187

Rank 3 · TkA01G621310 · TK1151

Lysosome / Vacuole0.058

Rank 4 · TkA01G621310 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA01G621310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30551CFAP251_C17-47 aa

PF10591SPARC_Ca_bdg18-86 aa

PF23564EF-hand_FSTL121-89 aa

PF30624EF_SSP12021-47 aa

PF21008AIF-122-91 aa

PF25825SAPC2_N24-89 aa

PF12763EH25-65 aa

PF04558tRNA_synt_1c_R125-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G621310	`PF30551`	CFAP251_C	17	47	1.3e-10	41.9
TkA01G621310	`PF10591`	SPARC_Ca_bdg	18	86	1e-06	29.8
TkA01G621310	`PF23564`	EF-hand_FSTL1	21	89	9.2e-08	33.2
TkA01G621310	`PF30624`	EF_SSP120	21	47	4.8e-06	27.8
TkA01G621310	`PF21008`	AIF-1	22	91	3e-11	44.4
TkA01G621310	`PF25825`	SAPC2_N	24	89	3.7e-06	27.4
TkA01G621310	`PF12763`	EH	25	65	8.3e-09	36.0
TkA01G621310	`PF04558`	tRNA_synt_1c_R1	25	71	0.24	12.1
TkA01G621310	`PF13499`	EF-hand_7	26	89	2.6e-36	124.5
TkA01G621310	`PF13833`	EF-hand_8	26	52	1.7e-25	89.2
TkA01G621310	`PF25530`	EF-hand_SWAP70_N	26	89	4.3e-07	30.6
TkA01G621310	`PF08976`	EF-hand_11	26	89	0.012	17.2
TkA01G621310	`PF25578`	EF-hand_STIM1	26	47	0.016	16.0
TkA01G621310	`PF24082`	SPEF2_C	26	47	0.15	12.5
TkA01G621310	`PF00036`	EF-hand_1	27	55	8.8e-34	113.3
TkA01G621310	`PF13405`	EF-hand_6	27	56	7.2e-29	97.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82659`	Arabidopsis thaliana	sp\|O82659\|CML20_ARATH Probable calcium-binding protein CML20	76.800%	Swiss-Prot	High
`O23184`	Arabidopsis thaliana	sp\|O23184\|CML19_ARATH Calcium-binding protein CML19	55.800%	Swiss-Prot	High
`Q7F0J0`	Oryza sativa subsp. japonica	sp\|Q7F0J0\|CML13_ORYSJ Probable calcium-binding protein CML13	62.100%	Swiss-Prot	High
`Q338P8`	Oryza sativa subsp. japonica	sp\|Q338P8\|CML8_ORYSJ Probable calcium-binding protein CML8	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card