TkA01G619470 | RubberDandelionOmics

Gene overview

TkA01G619470

Reference: TK1151 Chr: Chr01 Coordinates: 156344194-156346915 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2176 bp · TkA01G619470|TK1151|cDNA

GTGACACGAAGCTCCACACTCTCCATCTCTCCGACATTCGCTTCGTACTCCTCCACTTCTCTTGTTTAGATCGCTACCCTGGTTTCAATTTCTCACTCTCATTTCACTCTACAAAAATCACATCCATACATCTTCCCTAGTCCTTACTCCTTCAAGAAATGGGCGGATTCCCTTTCGATTCAAAATCAGGGCAGGCCATACTCTTGGTTCTTCTAGTAATGACTGCCTCTTTCTATACCGGAACCTTTTTCGGTCGCAAT...

CDS

Download CDS FASTA

555 bp · TkA01G619470|TK1151|CDS

ATGTCATTTGCTCCTAAAGATGGCCATGAAAATCAAATCCAGTTTGCTTTGGAACGTGGGATTAGTGCCATGATTTCAGCTTTAGCTACAAAACAGCTCCCTTATCCATCTCATTCATTTGAAATGGTTCATTGTTCAAGATGTCGTGTTGATTGGCACGAAAATGATGGGATTTTACTAAAGGAAATAAACCGACTTCTTAGACCAAATGGGTATTTTGTATATTCAGCCCCTCCAGCTTACAGAAAAGACAAGGATTA...

Protein

Download Protein FASTA

184 aa · TkA01G619470|TK1151|PROTEIN

MSFAPKDGHENQIQFALERGISAMISALATKQLPYPSHSFEMVHCSRCRVDWHENDGILLKEINRLLRPNGYFVYSAPPAYRKDKDYPVIWDKLVKLTSGMCWKLIAKKVQTAIWIKENDQTCLQHNEEKSIIKICDSVNNNNKPSWKTPLRNCISPGPTSNPKKLPPIPNVIRFTQKVLKKSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G619470`
TK1151 ID	TkA01G619470
OH-1004 ID	LXL04_000323
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 92.391 / OH-1004 28.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G619470

Location Chr01:156344194-156346915 (+)

Description Similar to At3g10200: Probable methyltransferase PMT6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04060`	Probable methyltransferase PMT7.	No verified direct reference in this release
`At3g10200`	Probable methyltransferase PMT6.	No verified direct reference in this release
`At5g14430`	Probable methyltransferase PMT9.	No verified direct reference in this release
`At4g14360`	Probable methyltransferase PMT3.	No verified direct reference in this release
`At3g23300`	Probable methyltransferase PMT1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G04430

ath:AT3G10200

ath:AT3G23300

ath:AT4G14360

ath:AT5G04060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.319

Rank 1 · TkA01G619470 · TK1151

Golgi apparatus0.288

Rank 2 · TkA01G619470 · TK1151

Cell membrane0.090

Rank 3 · TkA01G619470 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA01G619470 · TK1151

Lysosome / Vacuole0.065

Rank 5 · TkA01G619470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_291-163 aa

PF08241Methyltransf_1110-74 aa

PF13649Methyltransf_2524-71 aa

PF13847Methyltransf_3130-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G619470	`PF03141`	Methyltransf_29	1	163	5e-67	227.3
TkA01G619470	`PF08241`	Methyltransf_11	10	74	5.5e-06	27.6
TkA01G619470	`PF13649`	Methyltransf_25	24	71	0.001	20.4
TkA01G619470	`PF13847`	Methyltransf_31	30	83	0.023	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZA4`	Arabidopsis thaliana	sp\|Q9LZA4\|PMT7_ARATH Probable methyltransferase PMT7	77.400%	Swiss-Prot	High
`Q84TJ0`	Arabidopsis thaliana	sp\|Q84TJ0\|PMT6_ARATH Probable methyltransferase PMT6	75.500%	Swiss-Prot	High
`Q8VZV7`	Arabidopsis thaliana	sp\|Q8VZV7\|PMT9_ARATH Probable methyltransferase PMT9	49.000%	Swiss-Prot	Medium
`Q93YV7`	Arabidopsis thaliana	sp\|Q93YV7\|PMT3_ARATH Probable methyltransferase PMT3	50.000%	Swiss-Prot	High
`Q8H118`	Arabidopsis thaliana	sp\|Q8H118\|PMT1_ARATH Probable methyltransferase PMT1	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card