TkA01G618030 | RubberDandelionOmics

Gene overview

TkA01G618030

Reference: TK1151 Chr: Chr01 Coordinates: 155976643-155977470 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · TkA01G618030|TK1151|cDNA

ATGGCAGTGCAAGAAACTTTCCAGGCTCTTCCAACCGATATCTACTTAGCCACACAACCAAAAGCAGGTACAACATGGATTAAAGCACTCGCCTTTGCTATTGTGAACCGAACCAGAAACCCTAAAGATGTTTTGGTCTCTTGGTTTCACTTTGCAAACAAATTGAATGACAAATCTCTTGTTCAAATGACCATTGATGAGATGTTTGAGGAAGACATGAAAATAGACACTGGAAATAAAGTGAAGCGTCTAGCAGAGTT...

CDS

Download CDS FASTA

507 bp · TkA01G618030|TK1151|CDS

ATGGCAGTGCAAGAAACTTTCCAGGCTCTTCCAACCGATATCTACTTAGCCACACAACCAAAAGCAGGTACAACATGGATTAAAGCACTCGCCTTTGCTATTGTGAACCGAACCAGAAACCCTAAAGATGTTTTGGTCTCTTGGTTTCACTTTGCAAACAAATTGAATGACAAATCTCTTGTTCAAATGACCATTGATGAGATGTTTGAGGAAGACATGAAAATAGACACTGGAAATAAAGTGAAGCGTCTAGCAGAGTT...

Protein

Download Protein FASTA

168 aa · TkA01G618030|TK1151|PROTEIN

MAVQETFQALPTDIYLATQPKAGTTWIKALAFAIVNRTRNPKDVLVSWFHFANKLNDKSLVQMTIDEMFEEDMKIDTGNKVKRLAEFLGYPFTEEEEAGGGVQEIVRLCSFENLKEVNKKGDFREGVPNETFFREGKVGGWSNDLTTEMTNILDDITKAKFHGLDISF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G618030`
TK1151 ID	TkA01G618030
OH-1004 ID	LXL04_000344
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.100
Protein coverage (%)	TK1151 100.000 / OH-1004 78.613 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G618030

Location Chr01:155976643-155977470 (-)

Description Similar to SOT15: Cytosolic sulfotransferase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43690`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At3g45070`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of flavones and flavonols.	Biochemical and molecular characterization of flavonoid 7-sulfotransferase from Arabidopsis thaliana.2006 · DOI: 10.1016/j.plaphy.2006.10.004

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000344 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0051923 sulfation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008146 sulfotransferase activity Molecular Function

GO:0047366 quercetin-3-sulfate 4'-sulfotransferase activity Molecular Function

GO:0047894 flavonol 3-sulfotransferase activity Molecular Function

GO:0080131 hydroxyjasmonate sulfotransferase activity Molecular Function

KEGG gene cross-reference

ag:AAA33342

ag:AAA33343

ath:AT5G07000

ath:AT5G07010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583

Rank 1 · TkA01G618030 · TK1151

Endoplasmic reticulum0.144

Rank 2 · TkA01G618030 · TK1151

Peroxisome0.143

Rank 3 · TkA01G618030 · TK1151

Nucleus0.099

Rank 4 · TkA01G618030 · TK1151

Mitochondrion0.037

Rank 5 · TkA01G618030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00685Sulfotransfer_111-37 aa

PF20385DUF668026-95 aa

PF00685Sulfotransfer_138-70 aa

PF00685Sulfotransfer_171-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G618030	`PF00685`	Sulfotransfer_1	11	37	1e-28	101.2
TkA01G618030	`PF20385`	DUF6680	26	95	0.16	12.3
TkA01G618030	`PF00685`	Sulfotransfer_1	38	70	1e-28	101.2
TkA01G618030	`PF00685`	Sulfotransfer_1	71	164	1e-28	101.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG94`	Arabidopsis thaliana	sp\|Q9FG94\|SOT1_ARATH Cytosolic sulfotransferase 1	29.500%	Swiss-Prot	Low
`Q9M1V2`	Arabidopsis thaliana	sp\|Q9M1V2\|SOT5_ARATH Cytosolic sulfotransferase 5	27.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card