TkA01G617390 | RubberDandelionOmics

Gene overview

TkA01G617390

Reference: TK1151 Chr: Chr01 Coordinates: 155778811-155783478 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · TkA01G617390|TK1151|cDNA

CTACGACCCGGGTATATAAAGAAAAAAACCCTAGAAATTCTCACTCTTTCTCCATTTTGGCCGCGACTAGTTCCTGTCTCTCACCCCGGCGATTTCCGGCGAGGGTCTTAAGTGAGCTCCGGCGTCTTCCGGCCAACAAGGAATCTCCGACGCGACCTTCCTCCGACATCAGGTTCCTCGTCTGTCGTCGGAAATCGCTTTCCTCTGTCCTCCGACCAACCTTTTTCCTTCCGGTCAACCTTCTTCCTCCCGGCGACCTT...

CDS

Download CDS FASTA

534 bp · TkA01G617390|TK1151|CDS

ATGTTTTTCCACATTGTGCTGGAGCGAAACATGCAGCTCCACCCACGCCACTTCGGTCGCGACCTTCGTGAAAAACTCGTTTCAAAGCTCATGAAAGACGTAGAGGGAACTTGCAGTGGAAGACACGGTTTTGTTGTAGCCATAACTGGTATAGAGAATGTAGGGAAAGGGCTTATCAGAGATGGCACAGGTTTTGTTACTTTTCCTGTCAAGTATCAATGTGTTGTCTTTCGACCTTTCAAAGGGGAGATCCTAGAAGC...

Protein

Download Protein FASTA

177 aa · TkA01G617390|TK1151|PROTEIN

MFFHIVLERNMQLHPRHFGRDLREKLVSKLMKDVEGTCSGRHGFVVAITGIENVGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVISDPGSTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G617390`
TK1151 ID	TkA01G617390
OH-1004 ID	LXL04_000770
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	25.000
Protein coverage (%)	TK1151 76.271 / OH-1004 60.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G617390

Location Chr01:155778811-155783478 (+)

Description Similar to POLR3H: DNA-directed RNA polymerase III subunit RPC8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59180`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000770 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006139 nucleobase-containing compound metabolic process Biological Process

GO:0006383 transcription by RNA polymerase III Biological Process

GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process

GO:0006386 termination of RNA polymerase III transcription Biological Process

GO:0042797 tRNA transcription by RNA polymerase III Biological Process

GO:0045087 innate immune response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005666 RNA polymerase III complex Cellular Component

GO:0005813 centrosome Cellular Component

KEGG gene cross-reference

bta:767843

hsa:171568

mmu:78929

sce:YKL144C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.560

Rank 1 · TkA01G617390 · TK1151

Cytoplasm0.551

Rank 2 · TkA01G617390 · TK1151

Cell membrane0.124

Rank 3 · TkA01G617390 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA01G617390 · TK1151

Mitochondrion0.064

Rank 5 · TkA01G617390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03876SHS2_Rpb7-N8-64 aa

PF07545Vg_Tdu17-23 aa

PF07545Vg_Tdu73-87 aa

PF00575S179-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G617390	`PF03876`	SHS2_Rpb7-N	8	64	4.1e-15	56.4
TkA01G617390	`PF07545`	Vg_Tdu	17	23	0.36	11.5
TkA01G617390	`PF07545`	Vg_Tdu	73	87	0.36	11.5
TkA01G617390	`PF00575`	S1	79	156	1.4e-14	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P38421`	Arabidopsis thaliana	sp\|P38421\|NRPB7_ARATH DNA-directed RNA polymerase II subunit 7	90.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card