TkA01G616770 | RubberDandelionOmics

Gene overview

TkA01G616770

Reference: TK1151 Chr: Chr01 Coordinates: 155591765-155597348 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4112 bp · TkA01G616770|TK1151|cDNA

ATAACGGTCAAAAGTATTTCGAAGTACAGAATATAACAGCTAACATTTCCCTTCGGTCTGGGTCCCGCCAAATCTTTCATAAGCCAAGTCCAAATGCCATTAATGGTGACATGATTACAATTGAAAAACACTAAAACCCATTTCGTTATTCCGTTATTTTTCAATTAAAAAATCCTTCACTAATTGCTTAGAATTTAATGAATTTTAAAGTTGGTCGGGCAACCGGCGCATATGTAATAAATCATATATACAGAGAGGAA...

CDS

Download CDS FASTA

3006 bp · TkA01G616770|TK1151|CDS

ATGAGCGGTGTTTCTGGGGTAGTATCGAGGCAAGTTTTGCCAGCATGCGGACGCCTTTGTTTCTTCTGTCCAGCACTGACAACAAGATCTAGGCAACCCGTGAAGAGGTACAAGAAACTCATCTCAGATATTTTCCCCAGATCTCCGGGTGAAGAACCTAATGATAGAAAGATCGCAAAGCTCTGTGAATATGCTGGAAAAAATCCTTTACGTGTTCCAAAGATAACAATTACACTTGAGCATCGGTATTACAAGGAATT...

Protein

Download Protein FASTA

1001 aa · TkA01G616770|TK1151|PROTEIN

MSGVSGVVSRQVLPACGRLCFFCPALTTRSRQPVKRYKKLISDIFPRSPGEEPNDRKIAKLCEYAGKNPLRVPKITITLEHRYYKELRNENFQGAKIVMMIYRKLLISCKEQMPLFANSLLSIMQTLLDETRHDEMLIIGCQTLFDFINCQKDATYMFNLECFIAKLCQLAQEVGEDERVGPLRSAALQALSSMVWFMGRYSHISQEFDHIVSVVLENYGSLNKESDNSNQNRWVHEVLKTDHNVSPSEALIKVPSWTTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G616770`
TK1151 ID	TkA01G616770
OH-1004 ID	LXL04_000374
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G616770

Location Chr01:155591765-155597348 (+)

Description Similar to SRL2: Protein SEMI-ROLLED LEAF 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0308200`	Functions in regulating leaf rolling through abaxial side leaf cell differentiation.	Semi-Rolled Leaf2 modulates rice leaf rolling by regulating abaxial side cell differentiation.2016 · DOI: 10.1093/jxb/erw029

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000374 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030154 cell differentiation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

cbr:CBG_02625

cel:CELE_C32D5.3

dosa:Os03g0308200

hsa:23167

osa:4332616

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.466

Rank 1 · TkA01G616770 · TK1151

Nucleus0.311

Rank 2 · TkA01G616770 · TK1151

Cell membrane0.272

Rank 3 · TkA01G616770 · TK1151

Golgi apparatus0.087

Rank 4 · TkA01G616770 · TK1151

Endoplasmic reticulum0.069

Rank 5 · TkA01G616770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21072EFR349-148 aa

PF21052EFR3_ARM58-734 aa

PF27570TOF-1-like_helical83-134 aa

PF21072EFR3347-481 aa

PF28828ACF4_like354-418 aa

PF27570TOF-1-like_helical480-493 aa

PF28828ACF4_like766-807 aa

PF04282DUF438782-825 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G616770	`PF21072`	EFR3	49	148	0.039	13.5
TkA01G616770	`PF21052`	EFR3_ARM	58	734	7.5e-77	260.2
TkA01G616770	`PF27570`	TOF-1-like_helical	83	134	0.5	11.4
TkA01G616770	`PF21072`	EFR3	347	481	0.039	13.5
TkA01G616770	`PF28828`	ACF4_like	354	418	0.22	12.6
TkA01G616770	`PF27570`	TOF-1-like_helical	480	493	0.5	11.4
TkA01G616770	`PF28828`	ACF4_like	766	807	0.22	12.6
TkA01G616770	`PF04282`	DUF438	782	825	0.21	12.3
TkA01G616770	`PF16637`	zf-C2H2_assoc3	852	877	0.23	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10MI0`	Oryza sativa subsp. japonica	sp\|Q10MI0\|SRL2_ORYSJ Protein SEMI-ROLLED LEAF 2	33.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card