TkA01G604800 | RubberDandelionOmics

Gene overview

TkA01G604800

Reference: TK1151 Chr: Chr01 Coordinates: 152405517-152406445 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

790 bp · TkA01G604800|TK1151|cDNA

CAATCGTACATTTCAGGTCCCCGCCTGCTCGCCATCCACCTCTACATAACCAAACCATGTGAAAATTTGTTAATCACCGATACCCGAAGAATCAGCTCATTCTATCACCGTTACTTCGACGCTACAGAGAAGATGGACGCCGCCGGAAAAGTTAAGAAAGGTGCCGGAGGAAGAAAGGGAGGCGGTCCAAGGAAGAAGGCAGTTTCCCGTTCTGTCAAAGCCGGACTTCAGTTTCCAGTTGGTAGGGTTGGACGTTATCT...

CDS

Download CDS FASTA

588 bp · TkA01G604800|TK1151|CDS

CAATCGTACATTTCAGGTCCCCGCCTGCTCGCCATCCACCTCTACATAACCAAACCATGTGAAAATTTGTTAATCACCGATACCCGAAGAATCAGCTCATTCTATCACCGTTACTTCGACGCTACAGAGAAGATGGACGCCGCCGGAAAAGTTAAGAAAGGTGCCGGAGGAAGAAAGGGAGGCGGTCCAAGGAAGAAGGCAGTTTCCCGTTCTGTCAAAGCCGGACTTCAGTTTCCAGTTGGTAGGGTTGGACGTTATCT...

Protein

Download Protein FASTA

195 aa · TkA01G604800|TK1151|PROTEIN

QSYISGPRLLAIHLYITKPCENLLITDTRRISSFYHRYFDATEKMDAAGKVKKGAGGRKGGGPRKKAVSRSVKAGLQFPVGRVGRYLKKGRYAKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLLLAIRNDEELGKLLGGVTIAHGGVLPNINPILLPKKTAAKEPASPSKATKSPKKAKKAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G604800`
TK1151 ID	TkA01G604800
OH-1004 ID	LXL04_000533
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 77.436 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G604800

Location Chr01:152405517-152406445 (+)

Description Similar to Histone H2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WQG7`	Core component of nucleosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000533 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0070828 heterochromatin organization Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000786 nucleosome Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G02560

mtr:11418081

sly:101250163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA01G604800 · TK1151

Cytoplasm0.075

Rank 2 · TkA01G604800 · TK1151

Cell membrane0.014

Rank 3 · TkA01G604800 · TK1151

Extracellular0.013

Rank 4 · TkA01G604800 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA01G604800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone65-141 aa

PF26281Histone_ABTB67-106 aa

PF00808CBFD_NFYB_HMF77-140 aa

PF02861Clp_N113-150 aa

PF16211Histone_H2A_C144-176 aa

PF16211Histone_H2A_C188-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G604800	`PF00125`	Histone	65	141	1.8e-11	45.0
TkA01G604800	`PF26281`	Histone_ABTB	67	106	0.0013	19.1
TkA01G604800	`PF00808`	CBFD_NFYB_HMF	77	140	0.0011	19.9
TkA01G604800	`PF02861`	Clp_N	113	150	0.023	15.6
TkA01G604800	`PF16211`	Histone_H2A_C	144	176	3.2e-18	65.9
TkA01G604800	`PF16211`	Histone_H2A_C	188	193	3.2e-18	65.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2WQG7`	Oryza sativa subsp. indica	sp\|A2WQG7\|H2A5_ORYSI Probable histone H2A.5	80.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card