TkA01G602390 | RubberDandelionOmics

Gene overview

TkA01G602390

Reference: TK1151 Chr: Chr01 Coordinates: 151778867-151781484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkA01G602390|TK1151|cDNA

GTATAAAGTGTCTACGTCAATGTGATGTGTATGAGGTCATGACCCCACGAGCTGAGATTCCTTTTGACTGTCTGTCTTCTTCCTCCTCTCATGTAATTCGTCGTCACTCTCACCTTCACCTTCACCTTCACCGCTCCTAAATCTCATCGCCTGTTGGATTCCATGGCTTCCGCCATCGAAGCTGGATGGACGTACATGATCACTCATTTCAGTGACTTCCAGCTAGCTTGTGTTGGTAGCTTTATTCTTCATGAAGCTGT...

CDS

Download CDS FASTA

558 bp · TkA01G602390|TK1151|CDS

ATGCTTGCTTCCTACCCTGTCTTCAGATTCATGGGAATGAGAAGTAGCCTTCCACTGCCGTCCTGGAAAGTTATGTCGACTCAAATTCTATTCTACTTCATTGTGGAAGATTTCATATTTTACTGGGGACACAGAATTTTACATACCAAATGGCTTTACAAGCACATCCACAGTGTCCATCATGAATATGCAACACCTTTTGGATTGACATCTGAATATGCACATCCTGCTGAAATATTGTTCCTTGGATTTGCTACTAT...

Protein

Download Protein FASTA

185 aa · TkA01G602390|TK1151|PROTEIN

MLASYPVFRFMGMRSSLPLPSWKVMSTQILFYFIVEDFIFYWGHRILHTKWLYKHIHSVHHEYATPFGLTSEYAHPAEILFLGFATIFGPAITGPHLITLWLWMVVRVLETVEAHCGYHFPWSPSNFLPLYGGSDFHDYHHRLIYTKSGNYSSTFVYMDWIFGTDHGYRKLKALKSEEVAEFKQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G602390`
TK1151 ID	TkA01G602390
OH-1004 ID	LXL04_000563
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 69.030 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G602390

Location Chr01:151778867-151781484 (-)

Description Similar to SMO2-2: Methylsterol monooxygenase 2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29390`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the second methyl group at the C-4 position.	Sterol Methyl Oxidases Affect Embryo Development via Auxin-Associated Mechanisms.2016 · DOI: 10.1104/pp.15.01814
`At1g07420`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the second methyl group at the C-4 position.	Functional identification of sterol-4alpha-methyl oxidase cDNAs from Arabidopsis thaliana by complementation of a yeast erg25 mutant lacking sterol-4alpha-methyl oxidation.2001 · DOI: 10.1016/s0014-5793(01)03002-2 Sterol Methyl Oxidases Affect Embryo Development via Auxin-Associated Mechanisms.2016 · DOI: 10.1104/pp.15.01814

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BIM2`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os11g0707600`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`UniProt: B8B6I2`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008610 lipid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0080065 4-alpha-methyl-delta7-sterol oxidation Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0000254 C-4 methylsterol oxidase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0071771 aldehyde oxygenase (deformylating) activity Molecular Function

KEGG gene cross-reference

ath:AT1G07420

ath:AT2G29390

dosa:Os07g0101500

dosa:Os11g0707600

osa:4342171

osa:4351226

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.903

Rank 1 · TkA01G602390 · TK1151

Cytoplasm0.061

Rank 2 · TkA01G602390 · TK1151

Mitochondrion0.048

Rank 3 · TkA01G602390 · TK1151

Cell membrane0.044

Rank 4 · TkA01G602390 · TK1151

Nucleus0.044

Rank 5 · TkA01G602390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase30-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G602390	`PF04116`	FA_hydroxylase	30	164	3.6e-28	99.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW22`	Arabidopsis thaliana	sp\|Q9ZW22\|SMO21_ARATH Methylsterol monooxygenase 2-1	85.000%	Swiss-Prot	High
`Q8VWZ8`	Arabidopsis thaliana	sp\|Q8VWZ8\|SMO22_ARATH Methylsterol monooxygenase 2-2	89.100%	Swiss-Prot	High
`B8BIM2`	Oryza sativa subsp. indica	sp\|B8BIM2\|GLO1B_ORYSI Very-long-chain aldehyde decarbonylase GL1-11	81.500%	Swiss-Prot	High
`Q2QZ14`	Oryza sativa subsp. japonica	sp\|Q2QZ14\|GLO1B_ORYSJ Very-long-chain aldehyde decarbonylase GL1-11	81.500%	Swiss-Prot	High
`B8B6I2`	Oryza sativa subsp. indica	sp\|B8B6I2\|GLO18_ORYSI Very-long-chain aldehyde decarbonylase GL1-8	78.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card