TkA01G602100 | RubberDandelionOmics

Gene overview

TkA01G602100

Reference: TK1151 Chr: Chr01 Coordinates: 151670593-151670946 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA01G602100|TK1151|cDNA

ATGGAGCACTGCATGGACAAGAAATGGAAGCTATCGAAAGAAGATCCATGCAATCATTCGTCAAAATCGTCGTCGCTTTTAAGAAGCATTTCACAAAAAACCTCAACTAGTTCGAACCCTAAATCGTCGTTTTTTTCGAGAAGCTCGTCGCAAAAGCATAAGTGTACGCCGTCGGATCTGTCGAGAAGTTCGTCTCAAAAATGTGCGAACTTCACACGGAAATGTGGGAGTTTGGCGAAAGAACAGAAGGCGAGGTTTTA...

CDS

Download CDS FASTA

318 bp · TkA01G602100|TK1151|CDS

ATGGAGCACTGCATGGACAAGAAATGGAAGCTATCGAAAGAAGATCCATGCAATCATTCGTCAAAATCGTCGTCGCTTTTAAGAAGCATTTCACAAAAAACCTCAACTAGTTCGAACCCTAAATCGTCGTTTTTTTCGAGAAGCTCGTCGCAAAAGCATAAGTGTACGCCGTCGGATCTGTCGAGAAGTTCGTCTCAAAAATGTGCGAACTTCACACGGAAATGTGGGAGTTTGGCGAAAGAACAGAAGGCGAGGTTTTA...

Protein

Download Protein FASTA

105 aa · TkA01G602100|TK1151|PROTEIN

MEHCMDKKWKLSKEDPCNHSSKSSSLLRSISQKTSTSSNPKSSFFSRSSSQKHKCTPSDLSRSSSQKCANFTRKCGSLAKEQKARFYIVKRCVTMLVCWKKHGDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G602100`
TK1151 ID	TkA01G602100
OH-1004 ID	LXL04_000577
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 92.381 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G602100

Location Chr01:151670593-151670946 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59510`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At2g29125`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At3g55515`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At3g46613`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At2g39705`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000577 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0048367 shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53708

ath:AT2G39705

ath:AT3G55515

ath:AT5G59510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.402

Rank 1 · TkA01G602100 · TK1151

Nucleus0.377

Rank 2 · TkA01G602100 · TK1151

Cytoplasm0.337

Rank 3 · TkA01G602100 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA01G602100 · TK1151

Mitochondrion0.037

Rank 5 · TkA01G602100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08137DVL80-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G602100	`PF08137`	DVL	80	98	1.8e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE84`	Arabidopsis thaliana	sp\|Q8LE84\|DVL18_ARATH Small polypeptide DEVIL 18	56.300%	Swiss-Prot	Medium
`Q8L7D0`	Arabidopsis thaliana	sp\|Q8L7D0\|DVL13_ARATH Small polypeptide DEVIL 13	77.100%	Swiss-Prot	Low
`Q6IM93`	Arabidopsis thaliana	sp\|Q6IM93\|DVL8_ARATH Small polypeptide DEVIL 8	57.100%	Swiss-Prot	Low
`Q6IM86`	Arabidopsis thaliana	sp\|Q6IM86\|DVL15_ARATH Small polypeptide DEVIL 15	63.000%	Swiss-Prot	Low
`Q8S8S3`	Arabidopsis thaliana	sp\|Q8S8S3\|DVL11_ARATH Small polypeptide DEVIL 11	62.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card