Gene Card
Gene overview
cDNA / CDS / Protein Sequences
378 bp · TkA01G597650|TK1151|cDNA
ATGAGATCCAGAGTAGATGCTCAAGTAACCTATCAGCTCAATGCAGCTAACATGCTCAAAAAACAGGGAAATGAGTTTCACAGTCAGGGAAGGTATAGTGATGCCTTGGAGAAGTATATGCGGGCAAAAAACAATCTAAAAGGTATTCCGGCATCAAAAGGTGGAGGTGTCCTGCTGGCATGCTCTCTTAACATGATGTCATGTTACTTGAAAACAGGGGAATATGATGAGTGTATAAAAAAAGGTACTGAGGTATTGGC...
378 bp · TkA01G597650|TK1151|CDS
ATGAGATCCAGAGTAGATGCTCAAGTAACCTATCAGCTCAATGCAGCTAACATGCTCAAAAAACAGGGAAATGAGTTTCACAGTCAGGGAAGGTATAGTGATGCCTTGGAGAAGTATATGCGGGCAAAAAACAATCTAAAAGGTATTCCGGCATCAAAAGGTGGAGGTGTCCTGCTGGCATGCTCTCTTAACATGATGTCATGTTACTTGAAAACAGGGGAATATGATGAGTGTATAAAAAAAGGTACTGAGGTATTGGC...
Protein
Download Protein FASTA125 aa · TkA01G597650|TK1151|PROTEIN
MRSRVDAQVTYQLNAANMLKKQGNEFHSQGRYSDALEKYMRAKNNLKGIPASKGGGVLLACSLNMMSCYLKTGEYDECIKKGTEVLANDARNVKALYRRGQAHKNLGQLEKAVSDLSQALQRCSI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G597650 |
|---|---|
| TK1151 ID | TkA01G597650 |
| OH-1004 ID | LXL04_036743 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 33.000 |
| Protein coverage (%) | TK1151 87.200 / OH-1004 20.105Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G597650 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:150463816-150464661 (-) | |||||||||
| Description | Similar to FKBP62: Peptidyl-prolyl cis-trans isomerase FKBP62 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009408 response to heat Biological Process GO:0009611 response to wounding Biological Process GO:0009644 response to high light intensity Biological Process GO:0009845 seed germination Biological Process GO:0031111 negative regulation of microtubule polymerization or depolymerization Biological Process GO:0070370 cellular heat acclimation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G25230 ath:AT5G48570 bta:508535 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27421TP_0855_helical8-49 aaPF13424TPR_1211-43 aaPF13374TPR_1012-24 aaPF13176TPR_714-24 aaPF27144PA14_3316017-47 aaPF00515TPR_119-42 aaPF07719TPR_220-42 aaPF13432TPR_1622-39 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G597650 | PF27421 | TP_0855_helical | 8 | 49 | 0.0046 | 17.6 |
| TkA01G597650 | PF13424 | TPR_12 | 11 | 43 | 3e-07 | 31.2 |
| TkA01G597650 | PF13374 | TPR_10 | 12 | 24 | 0.16 | 12.7 |
| TkA01G597650 | PF13176 | TPR_7 | 14 | 24 | 0.0063 | 17.2 |
| TkA01G597650 | PF27144 | PA14_33160 | 17 | 47 | 0.014 | 16.4 |
| TkA01G597650 | PF00515 | TPR_1 | 19 | 42 | 7.2e-14 | 51.6 |
| TkA01G597650 | PF07719 | TPR_2 | 20 | 42 | 2.1e-12 | 46.8 |
| TkA01G597650 | PF13432 | TPR_16 | 22 | 39 | 4.2e-05 | 24.6 |
| TkA01G597650 | PF13414 | TPR_11 | 23 | 42 | 1.4e-09 | 38.2 |
| TkA01G597650 | PF13181 | TPR_8 | 23 | 42 | 1.5e-07 | 31.7 |
| TkA01G597650 | PF13428 | TPR_14 | 24 | 42 | 2.3e-05 | 25.3 |
| TkA01G597650 | PF13176 | TPR_7 | 26 | 41 | 0.0063 | 17.2 |
| TkA01G597650 | PF13374 | TPR_10 | 27 | 37 | 0.16 | 12.7 |
| TkA01G597650 | PF13431 | TPR_17 | 28 | 36 | 7e-06 | 26.6 |
| TkA01G597650 | PF14559 | TPR_19 | 28 | 39 | 0.0002 | 22.3 |
| TkA01G597650 | PF03704 | BTAD | 28 | 47 | 0.0024 | 18.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.