RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G597080
Reference: TK1151 Chr: Chr01 Coordinates: 150309136-150314184 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1498 bp · TkA01G597080|TK1151|cDNA

ATGAGAATACTCTCCTAATATAGAGTTTCCTTTCATGAAGTTTTGACGTAATCCAAAGAAGTTAGGTGATGATTTCAAGGTTATGGGTGAAGATTCTCATTTCCTATTCCTCCTATATTGTAACCTTGAAACCTCTGCTTTGCATAAGGTGCTCAAACAATTCTACCAAGAAAACCTTAATGGAATCATGACTTAGAATCCAAATTGACGGTGAAAGTCCCATCTTCATCCTACAATAACCCCACAGAAATTGTCATCAA...

CDS

Download CDS FASTA

873 bp · TkA01G597080|TK1151|CDS

ATGACTTTGTGCGCCGTCGACTCCCCCAGAGAACTCGCATGTCGCGACGGCCATGCGGCGGCGACGCTCAAGCTAATCTCCATGTTCGCCATATTTTTCACAAGCGTCGTCGGAATATCGGCACCGGTGATGCTTGCTCGTTTGTTTCACGGTAAGCCTCTATACGATAAAGCAATTTTGATCATCAAATGTTTCGCGGCGGGAGTCATTCTATCTACCTCACTTGTTCACGTGCTTCCCGACGCGTACGACGCTCTCGC...

Protein

Download Protein FASTA

290 aa · TkA01G597080|TK1151|PROTEIN

MTLCAVDSPRELACRDGHAAATLKLISMFAIFFTSVVGISAPVMLARLFHGKPLYDKAILIIKCFAAGVILSTSLVHVLPDAYDALANCQVSSHHPWKDFPFSGLITLVGVLTALLVDLTATSHVDGYSHGHGSNEVTAYTRINDSEELRKSVVEIEVMEAGEERRRLKEEEMVKMKQRMVSQVLEIGIIFHSVIIGVTMGMSQNQCTIKPLVAALAFHQIFEGMGLGGCIAQAGFKIGTTAYMCIMFSVTTPMGIMLGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G597080
TK1151 IDTkA01G597080
OH-1004 IDLXL04_032178
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)37.900
Protein coverage (%)TK1151 93.793 / OH-1004 72.443
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G597080
LocationChr01:150309136-150314184 (+)
DescriptionSimilar to IRT1: Fe(2+) transport protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g30080 May play a role in the transport of zinc in the plastids. No verified direct reference in this release
At5g45105 Probably mediates zinc uptake from the rhizosphere. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0164800 Zinc transporter that may be involved in zinc uptake from the rhizosphere. No verified direct reference in this release
Os05g0472700 Zinc transporter that mediates zinc uptake from the rhizosphere and may be responsible for the translocation of zinc within the plant.
OsZIP5 is a plasma membrane zinc transporter in rice.2010 · DOI: 10.1007/s11103-010-9637-0
Os05g0472400 Zinc transporter that may be involved in zinc uptake from the rhizosphere. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032178 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006826 iron ion transport Biological Process
GO:0006829 zinc ion transport Biological Process
GO:0015691 cadmium ion transport Biological Process
GO:0071577 zinc ion transmembrane transport Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0005385 zinc ion transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT1G31260
ath:AT2G04032
dosa:Os03g0667300
dosa:Os03g0667500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.770
Rank 1 · TkA01G597080 · TK1151
Endoplasmic reticulum0.091
Rank 2 · TkA01G597080 · TK1151
Cytoplasm0.089
Rank 3 · TkA01G597080 · TK1151
Lysosome / Vacuole0.077
Rank 4 · TkA01G597080 · TK1151
Golgi apparatus0.040
Rank 5 · TkA01G597080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535Zip22-283 aa
PF06979TMEM7023-38 aa
PF06979TMEM7056-180 aa
PF15757Amelotin60-85 aa
PF15757Amelotin96-260 aa
PF26273Gly_zipper187-202 aa
PF26273Gly_zipper217-232 aa
PF06979TMEM70240-257 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G597080PF02535Zip222839.4e-57193.4
TkA01G597080PF06979TMEM7023380.00816.8
TkA01G597080PF06979TMEM70561800.00816.8
TkA01G597080PF15757Amelotin60850.1112.8
TkA01G597080PF15757Amelotin962600.1112.8
TkA01G597080PF26273Gly_zipper1872022.98.3
TkA01G597080PF26273Gly_zipper2172322.98.3
TkA01G597080PF06979TMEM702402570.00816.8
TkA01G597080PF26273Gly_zipper2532622.98.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O64738Arabidopsis thalianasp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic66.300%Swiss-ProtHigh
Q8S3W4Arabidopsis thalianasp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 838.600%Swiss-ProtMedium
Q6L8F9Oryza sativa subsp. japonicasp|Q6L8F9|ZIP6_ORYSJ Zinc transporter 651.500%Swiss-ProtHigh
Q6L8G0Oryza sativa subsp. japonicasp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 539.700%Swiss-ProtMedium
Q0DHE3Oryza sativa subsp. japonicasp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 937.800%Swiss-ProtMedium

JBrowse

View in Genome Browser